DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mav and inhbab

Sequence 1:NP_524626.1 Gene:mav FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_001018166.1 Gene:inhbab ZFINID:ZDB-GENE-050525-2 Length:405 Species:Danio rerio

Alignment Length:336 Identity:72/337 (21%)
Similarity:117/337 (35%) Gaps:108/337 (32%)


  Fly   385 IDEANVRLMLLYSSSLATNFRRGPGSR-KNKISQISGNDNIERHCNFGDVNLNQSNKNSSQQLTL 448
            :::|||.|.|          :...||| |.|:|                |.|.|:.|..|.....
Zfish   159 VEQANVWLFL----------KVAKGSRVKGKVS----------------VQLLQNGKADSGSTDR 197

  Fly   449 KVYQLLSANRRRKITSRKIEFGNVGFQETRTQWIEFDVTKAVRSWLNKSHENLGIEIQCDKCKSI 513
            ...|::|   .:.|.:|            |:.|....|.:.|::.|:.....|.:.:.|..|...
Zfish   198 PEDQVVS---EKTIDTR------------RSGWHTLPVPRTVQTLLDGDSSLLSLRVSCPMCAEA 247

  Fly   514 GARILSDFSPSTPPRSTASSDEHLNLMPVLNIIGHGTL---NSQQHGDADIHQIMLTNNRSDQYV 575
            ||                        :|:| :...|..   ..|.|...    :|:....::::.
Zfish   248 GA------------------------VPIL-VPAEGNKVKEREQSHRPF----LMVVLKPAEEHQ 283

  Fly   576 HHRSNHDSTWRKDKWTNNCYKLHQRCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCPPR--- 637
            |.||         |....|....:.||:.|..|.||.|...::|:.|..:.|.||.|.||..   
Zfish   284 HRRS---------KRGLECDGKIRVCCKRQFYVNFKDIGWSDWIIAPSGYHANYCEGDCPSHVAS 339

  Fly   638 --------HNPAHHHALLQSLIWQEDHKRAP----RPCCTPSKLEMLEILHVDENHSDKLKISTW 690
                    |:...:|..::..        :|    :.||.|::|..:.:|:.  |...|:.....
Zfish   340 ITGSALSFHSTVINHYRMRGY--------SPFNNIKSCCVPTRLRAMSMLYY--NEEQKIIKKDI 394

  Fly   691 SDMQVVECACS 701
            .:|.|.||.||
Zfish   395 QNMIVDECGCS 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 11/64 (17%)
TGF_beta 599..700 CDD:278448 29/116 (25%)
inhbabNP_001018166.1 TGFb_propeptide 64..272 CDD:279078 35/183 (19%)
TGF_beta 298..404 CDD:278448 29/116 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.