DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mav and Inhbb

Sequence 1:NP_524626.1 Gene:mav FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_032407.1 Gene:Inhbb MGIID:96571 Length:411 Species:Mus musculus

Alignment Length:294 Identity:65/295 (22%)
Similarity:110/295 (37%) Gaps:79/295 (27%)


  Fly   436 NQSNKN-----SSQQLTLKVY-QLLSANRRRKITSRKIEFGNVGFQE----------------TR 478
            |:.|:|     :|..|.||:. .:|....|||:..:      |.|||                .|
Mouse   169 NEGNQNLFVVQASLWLYLKLLPYVLEKGSRRKVRVK------VYFQEQGHGDRWNVVEKKVDLKR 227

  Fly   479 TQWIEFDVTKAVRSWLNKSHENLGIEIQCDKCKSIGARILSDFSPSTPPRSTASSDEHLNLMPVL 543
            :.|..|.:|:|:::...:....|.:::|||.|                        :.|.::||.
Mouse   228 SGWHTFPITEAIQALFERGERRLNLDVQCDSC------------------------QELAVVPVF 268

  Fly   544 NIIGHGTLNSQQHGDADIHQIMLTNNRSDQYVHHRSNHDSTWRKDKWTNNCYKLHQRCCRNQLDV 608
            ...|     .:.|....:.|..|.::|      ||..        |....|......|||.|..:
Mouse   269 VDPG-----EESHRPFVVVQARLGDSR------HRIR--------KRGLECDGRTSLCCRQQFFI 314

  Fly   609 AFKSIKGFEFILQPKVFDAGYCHGRCP------PRHNPAHHHALLQSLIWQEDHKRAPRPCCTPS 667
            .|:.|...::|:.|..:...||.|.||      |....:.|.|::.....:..:......||.|:
Mouse   315 DFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGPVNSCCIPT 379

  Fly   668 KLEMLEILHVDENHSDKLKISTWSDMQVVECACS 701
            ||..:.:|:.|:.::  :......:|.|.||.|:
Mouse   380 KLSSMSMLYFDDEYN--IVKRDVPNMIVEECGCA 411

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 18/81 (22%)
TGF_beta 599..700 CDD:278448 27/107 (25%)
InhbbNP_032407.1 TGFb_propeptide 73..282 CDD:307025 30/148 (20%)
TGFB 307..410 CDD:214556 27/105 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.