DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34116 and CG11560

Sequence 1:NP_001036616.1 Gene:CG34116 FlyBaseID:FBgn0083952 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001303392.1 Gene:CG11560 FlyBaseID:FBgn0036249 Length:307 Species:Drosophila melanogaster

Alignment Length:287 Identity:79/288 (27%)
Similarity:122/288 (42%) Gaps:99/288 (34%)


  Fly     7 DIHEKIETGVYQLAVNDKSTRSTVWRVYRKIKKDDGSFLEHVLFCIGCRSIMSFTHKSTTNLRRH 71
            ||..||.:|.|:|.  .|:.||:||.|||:|.:.||:.|:...||:||:.:|..|..:|:|||.|
  Fly    27 DILMKINSGEYRLV--KKNKRSSVWNVYREIARPDGTKLKWRYFCMGCKRVMQSTGGTTSNLRIH 89

  Fly    72 RCHLQYLKKQAFCCYNSKGESND------------RKEET------------------------- 99
            :||::|:|:.......|....:|            :|.:|                         
  Fly    90 KCHVRYIKQNGHLTDGSHSYDHDPAPPASQPSPRVQKPKTRRPTSYSTQCEQFYEVTMDPETQYS 154

  Fly   100 --DQEHHEEHDDQQSM-----------------------SDELETKP-SPADVAAFV-------- 130
              |.|.....:::|::                       .:.|.|:| .|.|....|        
  Fly   155 DLDDEIEASLEEEQTIILQLKSKRELESSHSRPLLKLFSEENLSTEPEEPEDEIEIVEAEDQVPI 219

  Fly   131 ---------------GEAVSGGDSTAASARIPDIPEIALPLDASGVEESNVYAQTWSLEYRKLSE 180
                           |||:.           |...|.....||:.:.|:..||:.|:..:.:|:|
  Fly   220 ELDLCDIQHTTSDAGGEAIE-----------PKPTESVAQFDANAISEAESYAKAWAHAFLRLNE 273

  Fly   181 DQKFYAKKAIDEIFVLGRLRRLTLNTV 207
            |||||||::|||:.|||||.||:::||
  Fly   274 DQKFYAKRSIDELLVLGRLERLSISTV 300

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34116NP_001036616.1 ZnF_BED 29..74 CDD:214746 21/45 (47%)
CG11560NP_001303392.1 ZnF_BED 48..93 CDD:214746 22/45 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140885598
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0011443
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.