DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34116 and ssp

DIOPT Version :10

Sequence 1:NP_001036616.1 Gene:CG34116 / 4379912 FlyBaseID:FBgn0083952 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_648546.1 Gene:ssp / 39375 FlyBaseID:FBgn0036248 Length:368 Species:Drosophila melanogaster


Alignment Length:123 Identity:41/123 - (33%)
Similarity:62/123 - (50%) Gaps:26/123 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KFDD---IHEKIETGVYQLAVNDKSTRSTVWRVYRKIKKDDGSFLEHVLFCIGCRSIM-SFTHKS 64
            ||:.   |..|:..|.|:|.  .:..|.:||:|||:|.:.||:.:..:.||.||:.:| ||   :
  Fly    12 KFESNQVISAKVLRGEYRLL--RRKQRGSVWKVYREIVRTDGAIINGLYFCTGCKRVMRSF---N 71

  Fly    65 TTNLRRHRCHLQYLKKQAFCCYNSKGESNDRKEETDQEHHEEHDDQQSMSDELETKPS 122
            |:|||.|:||:.||:.:..|            ||...|.|     ...:.|.||.:.|
  Fly    72 TSNLRTHKCHVDYLRTEELC------------EEGIAEIH-----PPKLDDSLERRLS 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34116NP_001036616.1 ZnF_BED 29..74 CDD:214746 20/45 (44%)
sspNP_648546.1 Myb_DNA-bind_4 121..198 CDD:463994
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.