DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34116 and ssp

Sequence 1:NP_001036616.1 Gene:CG34116 FlyBaseID:FBgn0083952 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_648546.1 Gene:ssp FlyBaseID:FBgn0036248 Length:368 Species:Drosophila melanogaster

Alignment Length:123 Identity:41/124 (33%)
Similarity:62/124 (50%) Gaps:26/124 (21%)


  Fly     4 KFDD---IHEKIETGVYQLAVNDKSTRSTVWRVYRKIKKDDGSFLEHVLFCIGCRSIM-SFTHKS 64
            ||:.   |..|:..|.|:|.  .:..|.:||:|||:|.:.||:.:..:.||.||:.:| ||   :
  Fly    12 KFESNQVISAKVLRGEYRLL--RRKQRGSVWKVYREIVRTDGAIINGLYFCTGCKRVMRSF---N 71

  Fly    65 TTNLRRHRCHLQYLKKQAFCCYNSKGESNDRKEETDQEHHEEHDDQQSMSDELETKPS 122
            |:|||.|:||:.||:.:..|            ||...|.|     ...:.|.||.:.|
  Fly    72 TSNLRTHKCHVDYLRTEELC------------EEGIAEIH-----PPKLDDSLERRLS 112

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34116NP_001036616.1 ZnF_BED 29..74 CDD:214746 21/46 (46%)
sspNP_648546.1 Myb_DNA-bind_4 120..198 CDD:290549
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0011443
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.