DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RunxA and runx1

Sequence 1:NP_001259747.1 Gene:RunxA FlyBaseID:FBgn0083981 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_571678.1 Gene:runx1 ZFINID:ZDB-GENE-000605-1 Length:451 Species:Danio rerio

Alignment Length:463 Identity:176/464 (38%)
Similarity:224/464 (48%) Gaps:115/464 (25%)


  Fly    83 LAERTLGDFLTEHPGELIRTSSPLFVCTVLPPHWRSNKTLPVAFKVVSLGDIMDGTMVTVRAGND 147
            :|:|::.:.|::|||||:||.||.|:|:|||.|||.|||||:|||||:||||.|||:|||.||||
Zfish    51 MADRSMVEVLSDHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDIPDGTLVTVMAGND 115

  Fly   148 ENYCAELRNCTAVMKNQVAKFNDLRFVGRSGRGKSFTLTITVSTNPPHIATYNKAIKVTVDGPRE 212
            |||.|||||.||.:|||||:||||||||||||||||||||||.||||.:|||.:|||:|||||||
Zfish   116 ENYSAELRNATAAIKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYQRAIKITVDGPRE 180

  Fly   213 PRSKTML--------SLLGQQQQFHFAFGQRPFHF---STDPLSGFRMPPIG---------NCQS 257
            ||.....        :|...:|....|....|.|.   :|.|.  ...||.|         :.|.
Zfish   181 PRRHRQKPDEAVKPGALAFSEQLRRSAMRCSPHHGPAPNTRPT--LNTPPFGSPAHSQIPDSRQM 243

  Fly   258 ASNTHWGYGSAASAYSPYLA--SSGLSSCTTPTSAQFNNPALGFTCSSNDQSNNQDFGGATNRDC 320
            .::..|.|   ..:| |||.  |:.....|||.|.  |..||  .|.......:...|...:...
Zfish   244 QTSPSWSY---EQSY-PYLGPISTPAVHPTTPISP--NRTAL--HCPELTAFTDPRVGLERSFPS 300

  Fly   321 VPMLPDSTASDLDQHLSSLVGSTSGQMTHHSLLGAGGQTSISSTVNGASG-GGSAGAGTAGGGAG 384
            :|.|||...||      ..|...:|..|:           ..:.|..|.| |.||.:..||    
Zfish   301 LPSLPDGRFSD------PRVPYPTGAFTY-----------TPTPVTSAIGIGMSAMSSPAG---- 344

  Fly   385 SGGGAGGGAGGNSILVPRYHTNASNEYNVHSSQ---------NGPRSLSDSSQAESPVQEDLLTT 440
                             ||||.....|...|||         :.|..|..||.|.| .|..::.:
Zfish   345 -----------------RYHTYLPPAYPAGSSQAQAGAFQASSSPYHLYYSSAAGS-YQFSMMPS 391

  Fly   441 NTPNLGSTAGGGAANGGAG-------SNAGSGAAGSGAGGAGGASSAVGNPAMLGANQNFPGIVN 498
                      ||||.|...       :||.:|             ||:.:|::  .||: .|:|.
Zfish   392 ----------GGAAAGERSPPRILPCTNASTG-------------SALLHPSL--PNQS-EGVVE 430

  Fly   499 -QAQHSAA 505
             :..||::
Zfish   431 AEGSHSSS 438

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RunxANP_001259747.1 Runt 95..216 CDD:279225 97/121 (80%)
runx1NP_571678.1 Runt 63..184 CDD:307137 97/121 (80%)
Atrophin-1 <160..426 CDD:331285 90/341 (26%)
RunxI 359..451 CDD:312115 26/108 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3982
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000725
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11950
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.