DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RunxA and runx2b

Sequence 1:NP_001259747.1 Gene:RunxA FlyBaseID:FBgn0083981 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_998027.2 Gene:runx2b ZFINID:ZDB-GENE-040629-4 Length:464 Species:Danio rerio

Alignment Length:394 Identity:150/395 (38%)
Similarity:194/395 (49%) Gaps:91/395 (23%)


  Fly    86 RTLGDFLTEHPGELIRTSSPLFVCTVLPPHWRSNKTLPVAFKVVSLGDIMDGTMVTVRAGNDENY 150
            |::.:.:.:||.||:||.||.|:|:|||.|||.|||||||||||:||::.|||:|||.|||||||
Zfish    62 RSMAEIIADHPAELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGEVPDGTVVTVMAGNDENY 126

  Fly   151 CAELRNCTAVMKNQVAKFNDLRFVGRSGRGKSFTLTITVSTNPPHIATYNKAIKVTVDGPREPRS 215
            .|||||.:.|||||||:||||||||||||||||||||||.||||.:|||::|||||||||||||.
Zfish   127 SAELRNASGVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRR 191

  Fly   216 --------------KTMLSLLGQQQQFHFAF---GQRPFHFSTDPLSGFRMPPIGNC------QS 257
                          ...||.|.:.:|.....   .|.|....:.|.|   ..|.|..      |:
Zfish   192 HRPKLDDSPKAGLFSDRLSELERIRQTTMRVTVPTQTPRPSLSSPNS---YTPQGQTQITDPRQA 253

  Fly   258 ASNTHWGYGSAASAYSPYLASSGLSSCTTP----------------------------------- 287
            .|:..|.|.....:|...:||..:.| |||                                   
Zfish   254 QSSPPWSYDQTYPSYLSPMASPSVHS-TTPLSSSRATGLPSISDVPRRLPGSTDLSPFPGQFERQ 317

  Fly   288 -------TSAQFNNPAL----GFTCSSNDQSNNQDFGGATNRDCV-PMLPDSTASDLDQHLSS-- 338
                   |.::|::|.:    .||.:....:.....|.|.....: |..|.||.|......||  
Zfish   318 FPAFSSLTESRFSSPRMHYPATFTYTPTPVTTGMSLGSAHYHTYLPPPYPGSTQSQSGPFQSSST 382

  Fly   339 ---LVGSTSGQMTHHSLLGAGGQTSISSTVNGASGGGSAGAGTA-------GGGAGSGGGAGGGA 393
               ..|::||  ::...:..||:.|.:..:...:   ||..||:       ....||||..|.|:
Zfish   383 PYLYYGASSG--SYQFSMVPGGERSPTRMMPPCT---SASTGTSLVNPNLPVQADGSGGVEGDGS 442

  Fly   394 GGNS 397
            ..||
Zfish   443 HSNS 446

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RunxANP_001259747.1 Runt 95..216 CDD:279225 96/135 (71%)
runx2bNP_998027.2 Runt 71..192 CDD:279225 96/121 (79%)
RunxI 370..464 CDD:285676 22/83 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000725
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11950
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.