DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RunxA and runx2a

Sequence 1:NP_001259747.1 Gene:RunxA FlyBaseID:FBgn0083981 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_998023.1 Gene:runx2a ZFINID:ZDB-GENE-040629-3 Length:467 Species:Danio rerio

Alignment Length:498 Identity:165/499 (33%)
Similarity:211/499 (42%) Gaps:163/499 (33%)


  Fly    57 SNTEQNTPPTPAQLLNEAYTKMTSDILAE-------------RTLGDFLTEHPGELIRTSSPLFV 108
            |.:.:.:||:.:  |.....|| ||...|             ||:.:.:.:||.||:||.||.|:
Zfish    22 STSRRFSPPSSS--LQPVAGKM-SDAQPEPNAVVPRLRPHDNRTMVEIIADHPAELVRTDSPNFL 83

  Fly   109 CTVLPPHWRSNKTLPVAFKVVSLGDIMDGTMVTVRAGNDENYCAELRNCTAVMKNQVAKFNDLRF 173
            |:|||.|||.|||||||||||:|||:.|||:|||.|||||||.|||||.:||||||||:||||||
Zfish    84 CSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRF 148

  Fly   174 VGRSGRGKSFTLTITVSTNPPHIATYNKAIKVTVDGPREPR------------------------ 214
            ||||||||||||||||.||||.:|||::|||||||||||||                        
Zfish   149 VGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKLEDPPKPPLFSERLSELER 213

  Fly   215 -SKTMLSLLGQQQQFHFAFGQRPFHFS-------TDPLSGFRMPPIGNCQSASNTHWGYGSAASA 271
             .:|.:.:..|.|....:....|..|:       :||......||           |.|   ...
Zfish   214 LRQTTMRVAVQTQSPRPSLNATPNSFNPQGQTQISDPRQAQSSPP-----------WSY---EQP 264

  Fly   272 YSPYLA---SSGLSSCTTPTSAQFNNPALGFTCSSNDQSNNQDFGGATNRDCVPMLPD-----ST 328
            |.|||:   |..:.| |||.|                         :|....:|.:.|     |.
Zfish   265 YPPYLSQMTSPSIHS-TTPLS-------------------------STRATGLPTISDVPRRLSG 303

  Fly   329 ASDLD-------------QHLSSLVGSTSGQMTHHSLLGAGGQTSISSTVNGASGGGSAGAGTAG 380
            .|:|.             ..||||..|.......|.      ..:.:.|....:.|.|.|..|  
Zfish   304 TSELSPFSADPRQFERQFPSLSSLTDSRFPSPRMHY------PATFTYTPTPVTSGMSLGMST-- 360

  Fly   381 GGAGSGGGAGGGAGGNSILVPRYHTNASNEY-NVHSSQNGPRSLSDS------------------ 426
                               ...|||.....| ....:|:||...|.:                  
Zfish   361 -------------------TTHYHTYLPPPYPGSTQNQSGPFQTSSTPYLYYGASSGSYQFPMVP 406

  Fly   427 --SQAESPVQEDLLTTNT------PNLGSTAGGGAANGGAGSN 461
              .::.|.:.....:.:|      |||.:...||.|:|...|:
Zfish   407 GGDRSPSRMLPPCTSASTGSTLINPNLPNQTDGGEADGSHSSS 449

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RunxANP_001259747.1 Runt 95..216 CDD:279225 98/146 (67%)
runx2aNP_998023.1 Runt 70..191 CDD:279225 98/121 (81%)
RunxI 376..467 CDD:285676 14/75 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3982
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000725
OrthoInspector 1 1.000 T128619
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11950
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.