DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RunxA and RunxB

Sequence 1:NP_001259747.1 Gene:RunxA FlyBaseID:FBgn0083981 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_001259745.1 Gene:RunxB FlyBaseID:FBgn0259162 Length:663 Species:Drosophila melanogaster

Alignment Length:733 Identity:245/734 (33%)
Similarity:325/734 (44%) Gaps:196/734 (27%)


  Fly     4 TTTSSNSTASNANNNNNNTANNNNTSSNNNTTNTNGSSNNNTSGNNNNSSGNNSNTEQ-NTPPTP 67
            |||...:..|:|::||||  |||.:::|||.||.|   ||:|:.||||::.||..|:. :|.|  
  Fly    42 TTTKRRNAESSASSNNNN--NNNTSTTNNNNTNNN---NNSTTNNNNNNNNNNVKTKPVDTSP-- 99

  Fly    68 AQLLNEAYTKMTSDILAERTLGDFLTEHPGELIRTSSPLFVCTVLPPHWRSNKTLPVAFKVVSLG 132
                     .:|.:.|.|||:...|.||||||::|.||..|||.||.|||||||||:||||::||
  Fly   100 ---------YLTPENLIERTVDVLLAEHPGELVKTGSPHVVCTTLPTHWRSNKTLPIAFKVLALG 155

  Fly   133 DIMDGTMVTVRAGNDENYCAELRNCTAVMKNQVAKFNDLRFVGRSGRGKSFTLTITVSTNPPHIA 197
            ::||||:||:|||||||:|.|||||||||||||||||||||||||||||||||||.:||||..||
  Fly   156 EVMDGTIVTIRAGNDENFCGELRNCTAVMKNQVAKFNDLRFVGRSGRGKSFTLTIVISTNPIQIA 220

  Fly   198 TYNKAIKVTVDGPREPRSKTMLSLLGQQQQFH-FAFGQRPFHFSTDPLSG---FRMPPIGNCQSA 258
            ||.||||||||||||||||.      :.|.|| ||||  |..|..|||..   |::|...:....
  Fly   221 TYTKAIKVTVDGPREPRSKV------RHQGFHPFAFG--PQRFGPDPLMAGLPFKLPGFAHHLVG 277

  Fly   259 SNTH-----W------GYGSAASAYSPYLASSGLSSCTTPTSAQFNNPALGFTCSSNDQSNNQDF 312
            .::|     |      |...||...:|:.   |..:...||       |.|....|.|...:|  
  Fly   278 MHSHLHAPDWRAHMALGGRPAAFTAAPFF---GHHAAAFPT-------ASGLRGLSGDSQQHQ-- 330

  Fly   313 GGATNRDCVPMLPDSTASDLDQHLSSLVGSTSGQMTHHSLLGAGGQTSISSTVNGASGGGSAGAG 377
                             ....||..:.||:.      ||.....|..:.::|     .|....|.
  Fly   331 -----------------QQQQQHQLATVGAA------HSTTSPEGSPTTTTT-----SGTQLSAF 367

  Fly   378 TAGGGAGSGGGAGGGAGGNSILVPRYHTNASNEYNVHSSQNGPRSLSDSSQAESPVQEDLLT-TN 441
            .......|               |...|:..::.|.::|.|.    :.||..::..:.|.:: |.
  Fly   368 VQPPMTSS---------------PPPVTSLQHDNNNNNSNNN----NSSSHIDAGFESDSISVTG 413

  Fly   442 TP--NLGS--------TAGGGAANGGAGSNAGSGAAGSGAGGAGGASSAVGNPAMLGANQNFPGI 496
            :|  :|||        ......|...|.:.|.....|..:...||....:.:.:..|:...|..:
  Fly   414 SPRKSLGSPLTHDEEEAEAEAEAEAEAEAEAEEAEVGGLSRNGGGIQGPLHSESSPGSGGAFTAL 478

  Fly   497 VNQAQHSAASAYG-----GGTGVVGGGHGSAAAAAAGCNGSLY---PVLPAS--LLYSQLYTAAN 551
            :.::..:....:|     ||......||....|.||    .|:   |:||.|  .||:|||    
  Fly   479 IQRSGKNPTELFGGFAAAGGNHFAPSGHSFNPALAA----QLFLQSPLLPQSSQWLYTQLY---- 535

  Fly   552 QSAHGFHSHTLP------AHASPNSSVHGELQSVMDHISNVGVRQQHNIMAGGGVTHPGDLTLIG 610
                |.:| .||      |.|:.|.:...|         |.|:..     .|....|.| :.||.
  Fly   536 ----GSYS-DLPWLRNAAAAAAANINPGQE---------NSGIPP-----LGSNPDHDG-VNLIK 580

  Fly   611 NCGASVR----NIEDGNSNRQVAALAAHR------------------------GHHNPTDNGGS- 646
            .|...:.    :.|:.|.|......:..|                        ||......||: 
  Fly   581 RCVTLITHNPPDAENANPNASPPVSSTRRSPSPVETIDLDDVSTTSRSASGSSGHGGGVGGGGAV 645

  Fly   647 -------------VWRPY 651
                         |||||
  Fly   646 GPIRTRTPKPSADVWRPY 663

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RunxANP_001259747.1 Runt 95..216 CDD:279225 100/121 (83%)
RunxBNP_001259745.1 Runt 118..239 CDD:279225 100/121 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3982
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 223 1.000 Inparanoid score I3439
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000725
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11950
RoundUp 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.