DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RunxA and lz

Sequence 1:NP_001259747.1 Gene:RunxA FlyBaseID:FBgn0083981 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_511099.2 Gene:lz FlyBaseID:FBgn0002576 Length:826 Species:Drosophila melanogaster

Alignment Length:748 Identity:223/749 (30%)
Similarity:300/749 (40%) Gaps:237/749 (32%)


  Fly     5 TTSSNSTASNANNNNNNTANNNNTSSNNNTTNTNGSSNNNTSGNNNNSSGNNSNTEQNTPPTPAQ 69
            :..|:|....|:|...::.::.:|..::::|    :||||.:|.:|::|.||:...|        
  Fly   215 SVGSSSPTGGASNGTAHSGHSGHTGGHSSST----ASNNNNNGASNSNSNNNNAVHQ-------- 267

  Fly    70 LLNEAYTKMTSDIL-AERTLGDFLTEHPGELIRTSSPLFVCTVLPPHWRSNKTLPVAFKVVSLGD 133
                       |:| .||.:.....||||||:|||:|.|:|:.||.|||||||||:|||||:|.:
  Fly   268 -----------DLLWMERLVQKRQQEHPGELVRTSNPYFLCSALPAHWRSNKTLPMAFKVVALAE 321

  Fly   134 IMDGTMVTVRAGNDENYCAELRNCTAVMKNQVAKFNDLRFVGRSGRGKSFTLTITVSTNPPHIAT 198
            :.|||.||:|||||||.||||||.|..|||.|||||||||||||||||||||||||:|:||.:||
  Fly   322 VGDGTYVTIRAGNDENCCAELRNFTTQMKNDVAKFNDLRFVGRSGRGKSFTLTITVATSPPQVAT 386

  Fly   199 YNKAIKVTVDGPREPRSKTMLSLLGQQQQFHFAFGQRPFHFSTDPLSGF-------------RMP 250
            |.|||||||||||||||||  |..|.........||||:      :.||             |..
  Fly   387 YAKAIKVTVDGPREPRSKT--SPTGGPHYRALGLGQRPY------IDGFPSTKALHELESLRRSA 443

  Fly   251 PIGNCQSASNTHWGYGSAASAYSPYLASSGLSSCTTPTSAQFNNPALGFT----------CSSND 305
            .:....:|:.......|||:|    :|::..:...|||.......|.|..          .|||.
  Fly   444 KVAAVTTAAAAAATAASAANA----VAAAAAAVAVTPTGGGGGVAAGGVAGGAGAGLVQQLSSNY 504

  Fly   306 QSNNQDFGGATNRDCVPMLPDSTASDLDQHLSSLVGSTSGQMT--------------------HH 350
            .|.|    ...|.||....|::      .|:.:.....:|:.|                    ||
  Fly   505 SSPN----STINSDCQVYKPNA------PHIQAAEMMGAGEWTNGSSSSAAAYYHSHAHHPHAHH 559

  Fly   351 S----------------------LLGAGGQTSISSTVNGASGGGSAGAGTAGGGAGSGGGAGGGA 393
            :                      .:|.||        |||:.|...|.|.   |.|.....||..
  Fly   560 AHAHLQHQMALPPPPPPPAAAPVSVGVGG--------NGATMGMGMGVGV---GMGMNHYGGGYD 613

  Fly   394 GGNSILVPRYHTNASNEYNVHSSQNGPRSLSDSSQAESPVQEDLLTTNTPNLGSTAGGGAANGGA 458
            ..||:        .:.:|..|.....| .:.....|..|.|             |||.|..|.|.
  Fly   614 SANSL--------EAGQYAAHLPAVLP-EMHGHGFATDPYQ-------------TAGYGGGNTGG 656

  Fly   459 GSNAGSGAAGSGAGGAGGASSAVGNPAMLGANQNFPGIVNQAQHSAASAYGGGTGVVGGGHGSAA 523
            ||.:.|                         ..::.|..|||..:....|..|:.:....:|..|
  Fly   657 GSASKS-------------------------ELDYGGSYNQAWSNGYQNYQYGSCLATAQYGPQA 696

  Fly   524 AAAAGCNGSLYPVLPASLLYSQLYTAANQSAHGFHSHTLPAHASPNSSVHGELQSVMDHISNVGV 588
            |..     ...|..|..:|..|||:..||:....|.|:           ..:|:..:        
  Fly   697 APP-----PQPPPPPPVVLCPQLYSTVNQNQIHLHLHS-----------SEKLEQYL-------- 737

  Fly   589 RQQHNIMAGGGVTHPGDLTLIGNCGASVRNIEDG---------NSNRQVAALAAHRGHHNPTDN- 643
                     |..|....||:....|:|..:||.|         ::.:|.......:..|:|... 
  Fly   738 ---------GTATSADHLTIGSLTGSSRSSIEIGQDQYHQQVHHAQQQQQQQQQQQQVHHPQQQQ 793

  Fly   644 -------GGS------------------VWRPY 651
                   |||                  |||||
  Fly   794 VESAGEVGGSGAGGVESAREEDVGDLSQVWRPY 826

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RunxANP_001259747.1 Runt 95..216 CDD:279225 96/121 (79%)
lzNP_511099.2 Runt 283..404 CDD:279225 96/121 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3982
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000725
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11950
RoundUp 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.