DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RunxA and Runx3

Sequence 1:NP_001259747.1 Gene:RunxA FlyBaseID:FBgn0083981 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_062706.2 Gene:Runx3 MGIID:102672 Length:423 Species:Mus musculus

Alignment Length:394 Identity:154/395 (39%)
Similarity:191/395 (48%) Gaps:88/395 (22%)


  Fly    86 RTLGDFLTEHPGELIRTSSPLFVCTVLPPHWRSNKTLPVAFKVVSLGDIMDGTMVTVRAGNDENY 150
            |::.|.|.:|.|||:||.||.|:|:|||.|||.|||||||||||:|||:.|||:|||.|||||||
Mouse    68 RSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENY 132

  Fly   151 CAELRNCTAVMKNQVAKFNDLRFVGRSGRGKSFTLTITVSTNPPHIATYNKAIKVTVDGPREPRS 215
            .|||||.:||||||||:||||||||||||||||||||||.|||..:|||::||||||||||||| 
Mouse   133 SAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPR- 196

  Fly   216 KTMLSLLGQQQQFHFAFG---------------------------QRPFHFSTDPLSGFRMP--- 250
            :....:..|.:.|...||                           |.|...|:| |:.|..|   
Mouse   197 RHRQKIEDQTKAFPDRFGDLRMRVTPSTPSPRGSLSTTSHFSSQAQTPIQGSSD-LNPFSDPRQF 260

  Fly   251 --PIGNCQSASNTHW-----GYGSAASAYSPYLAS-SG-----LSSCTTPTSAQFNNPALGFTCS 302
              .....||.:.:.:     .|..|.||..||.|: ||     ||....|.|::|::..|.....
Mouse   261 DRSFPTLQSLTESRFPDPRMHYPGAMSAAFPYSATPSGTSLGSLSVAGMPASSRFHHTYLPPPYP 325

  Fly   303 SNDQSNNQDFGGATNRDCVPMLPDSTASDLDQHLSSLVGSTSGQMTHHSLLGAGGQTSISSTVNG 367
            ...||.:..|               .|:....||  ..|::||..........||:.|.:..:..
Mouse   326 GAPQSQSGPF---------------QANPAPYHL--FYGASSGSYQFSMAAAGGGERSPTRMLTS 373

  Fly   368 ASGGGSAGAGTAGG---GAGSGGGAGGGAGGNSILVPRYHTNASNEYNVHSSQNGPRSLSDSSQA 429
            ...|.|..||....   |...|..|.|                       |..|.|.:||...:.
Mouse   374 CPSGASVSAGNLMNPSLGQADGVEADG-----------------------SHSNSPTALSTPGRM 415

  Fly   430 ESPV 433
            :..|
Mouse   416 DEAV 419

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RunxANP_001259747.1 Runt 95..216 CDD:279225 97/121 (80%)
Runx3NP_062706.2 Runt 77..198 CDD:279225 97/122 (80%)
RunxI 328..423 CDD:285676 26/133 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3982
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 215 1.000 Inparanoid score I3583
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000725
OrthoInspector 1 1.000 T130894
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11950
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.920

Return to query results.
Submit another query.