DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RunxA and Runx2

Sequence 1:NP_001259747.1 Gene:RunxA FlyBaseID:FBgn0083981 Length:663 Species:Drosophila melanogaster
Sequence 2:XP_006523603.1 Gene:Runx2 MGIID:99829 Length:652 Species:Mus musculus

Alignment Length:286 Identity:131/287 (46%)
Similarity:158/287 (55%) Gaps:65/287 (23%)


  Fly    86 RTLGDFLTEHPGELIRTSSPLFVCTVLPPHWRSNKTLPVAFKVVSLGDIMDGTMVTVRAGNDENY 150
            ||:.:.:.:||.||:||.||.|:|:|||.|||.|||||||||||:||::.|||:|||.|||||||
Mouse   211 RTMVEIIADHPAELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGEVPDGTVVTVMAGNDENY 275

  Fly   151 CAELRNCTAVMKNQVAKFNDLRFVGRSGRGKSFTLTITVSTNPPHIATYNKAIKVTVDGPREPR- 214
            .|||||.:||||||||:||||||||||||||||||||||.||||.:|||::||||||||||||| 
Mouse   276 SAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRR 340

  Fly   215 -------SK-----TMLSLLGQ-----------QQQFHFAFGQRPFHFS-------TDPLSGFRM 249
                   ||     ..||.||:           .|....:....|..|:       |||......
Mouse   341 HRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITDPRQAQSS 405

  Fly   250 PPIGNCQSASNTHWGYGSAASAYSPYLASSGLSSCTTPTSAQFNN--PALGFTCSSNDQSNNQDF 312
            ||           |.|..:..:|...:.|..:.| |||.|:....  ||:               
Mouse   406 PP-----------WSYDQSYPSYLSQMTSPSIHS-TTPLSSTRGTGLPAI--------------- 443

  Fly   313 GGATNRDCVPMLPDSTASDLDQHLSS 338
                 .|....:.||..|.||...|:
Mouse   444 -----TDVPRRISDSEPSTLDSQSST 464

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RunxANP_001259747.1 Runt 95..216 CDD:279225 98/129 (76%)
Runx2XP_006523603.1 Runt 220..341 CDD:279225 97/121 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3982
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000725
OrthoInspector 1 1.000 T130894
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11950
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.870

Return to query results.
Submit another query.