DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Thd1 and TDG

Sequence 1:NP_001259060.1 Gene:Thd1 FlyBaseID:FBgn0026869 Length:1738 Species:Drosophila melanogaster
Sequence 2:NP_003202.3 Gene:TDG HGNCID:11700 Length:410 Species:Homo sapiens

Alignment Length:387 Identity:153/388 (39%)
Similarity:214/388 (55%) Gaps:75/388 (19%)


  Fly   705 INFKPMPKK---------------RGRKKKLVAVNADTSQMTTPVDQQKVSAGRADCEDGGGDQA 754
            :|.:.||::               :|||:|     ..|::...||:.:|      ..|.....::
Human    35 VNEQQMPEEVPAPAPAQEPVQEAPKGRKRK-----PRTTEPKQPVEPKK------PVESKKSGKS 88

  Fly   755 AKPKE-----------RKKHDRFNGMSEEEVIKRTIPDHLCDNLDIVIVGINPGLFAAYKGHHYA 808
            ||.||           ::|.|||||:||.|::.:|:||.|..||||||:||||||.||||||||.
Human    89 AKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYP 153

  Fly   809 GPGNHFWKCLYLAGLTQEQMSADEDHKLI-KQGIGFTNMVARATKGSADLTRKEIKEGSRILLEK 872
            ||||||||||:::||::.|::..:||.|. |.||||||||.|.|.||.||:.||.:||.|||::|
Human   154 GPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQK 218

  Fly   873 LQRFRPKVAVFNGKLIFEVFSGK------KEFHFGRQPDRVDGTDTFIWVMPSSSARCAQLPRAA 931
            ||:::|::||||||.|:|:||.:      |...||.||.::..|:|..:|||||||||||.|||.
Human   219 LQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQ 283

  Fly   932 DKVPFYAALKKFRDFLNGQIPHIDESECVFTDQRIRLCSAQQQVDIVGKINKTHQP--------P 988
            |||.:|..||..||.|.|...::|..|..:|   ..|..||:....:....:.:.|        .
Human   284 DKVHYYIKLKDLRDQLKGIERNMDVQEVQYT---FDLQLAQEDAKKMAVKEEKYDPGYEAAYGGA 345

  Fly   989 LGDHPSSLTVVSNCSGPIAGDAECGIVAEESDQVQSEK----------MIPQMDPTVPSSSN 1040
            .|::|        ||....|.:..|::  ||.:::.|.          |.......:||.||
Human   346 YGENP--------CSSEPCGFSSNGLI--ESVELRGESAFSGIPNGQWMTQSFTDQIPSFSN 397

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Thd1NP_001259060.1 UDG_like 714..962 CDD:294330 131/266 (49%)
TDGNP_003202.3 mug 2..329 CDD:273154 138/308 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C316591551
eggNOG 1 0.900 E1_COG3663
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S7652
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003740
OrthoInspector 1 1.000 T1073622
orthoMCL 1 0.900 OOG5_130139
Panther 1 1.100 LDO PTHR12159
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1493
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.680

Return to query results.
Submit another query.