DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Thd1 and tdg.2

Sequence 1:NP_001259060.1 Gene:Thd1 FlyBaseID:FBgn0026869 Length:1738 Species:Drosophila melanogaster
Sequence 2:XP_687336.3 Gene:tdg.2 ZFINID:ZDB-GENE-131121-30 Length:400 Species:Danio rerio

Alignment Length:353 Identity:145/354 (41%)
Similarity:191/354 (54%) Gaps:70/354 (20%)


  Fly   712 KKRGRKKKLVAVNADTSQMTTPVDQQKVSAGRADCEDGGGDQAAKPKERKKHDRFNGMSEEEVIK 776
            |||||.:|             ..:::|..|          :::|| |.::..|||||||.|||:.
Zfish    90 KKRGRPRK-------------GEEREKTEA----------EESAK-KAKRTLDRFNGMSVEEVMA 130

  Fly   777 RTIPDHLCDNLDIVIVGINPGLFAAYKGHHYAGPGNHFWKCLYLAGLTQEQMSADEDHKLIKQ-G 840
            |.:||.:..|||::|:||||||.:||||.||..|||||||||:|:|||.||::...|..|.:. |
Zfish   131 RKLPDVITHNLDMLIIGINPGLLSAYKGRHYPNPGNHFWKCLFLSGLTNEQLNHMHDQTLPEHYG 195

  Fly   841 IGFTNMVARATKGSADLTRKEIKEGSRILLEKLQRFRPKVAVFNGKLIFEVFSGK------KEFH 899
            |||||||.|.|.||.||:.|||:||...||||||.:||.:||||||.|:|:|..:      |...
Zfish   196 IGFTNMVERTTPGSKDLSNKEIREGGHQLLEKLQTYRPLIAVFNGKCIYEIFCKEIFGVKAKNLE 260

  Fly   900 FGRQPDRVDGTDTFIWVMPSSSARCAQLPRAADKVPFYAALKKFRDFLNG--QIPHIDESECVF- 961
            ||.||.:|..|:|..::|||||.||||.|||.|||.||..||:.||.|.|  :...|.|:...| 
Zfish   261 FGLQPYKVPETETVCYLMPSSSPRCAQFPRAQDKVHFYIKLKELRDQLKGVTKTQEIQETNYSFD 325

  Fly   962 ----TDQRIRLCSAQQQVDIVGKINKTH------QPPLGDHPSSLTVVSNCSGPIAGDAECGIVA 1016
                .:...|:...::|.|...:....|      |...|.|||:.|                   
Zfish   326 LNLAKEDAKRMAIKEEQNDPGYEETCAHGSWGEPQQAFGVHPSTNT------------------- 371

  Fly  1017 EESDQVQSEK--MIP--QMDPTVPSSSN 1040
               |||..::  |.|  :..|.:..|:|
Zfish   372 ---DQVMDDRWTMQPFAEQIPDIRCSNN 396

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Thd1NP_001259060.1 UDG_like 714..962 CDD:294330 125/262 (48%)
tdg.2XP_687336.3 UDG_like <83..338 CDD:294330 128/272 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C316590595
eggNOG 1 0.900 E1_COG3663
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003740
OrthoInspector 1 1.000 T597206
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12159
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1493
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.