DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Thd1 and Tdg-ps

Sequence 1:NP_001259060.1 Gene:Thd1 FlyBaseID:FBgn0026869 Length:1738 Species:Drosophila melanogaster
Sequence 2:XP_006521693.1 Gene:Tdg-ps MGIID:3645587 Length:421 Species:Mus musculus

Alignment Length:436 Identity:162/437 (37%)
Similarity:227/437 (52%) Gaps:80/437 (18%)


  Fly   641 YSFMGEELHMHSPSHRHLDAVTTGPGRYGILVSNDTPECLSREMYRHSQQSTTVLEQTDSSSCGI 705
            |||:.:::....|:.    ||.||                 :::...:....||.||...:...:
Mouse    18 YSFLFQQMMAEVPNM----AVMTG-----------------QQVPAVAPNMATVTEQQVPTDAPV 61

  Fly   706 NFKP---MPKKRGRKKKLVAVNADTSQMTTPVDQQKVSAGRADCEDGGGDQAAKPKERK------ 761
            . :|   .||:|.||.:       .::...||:.:|    .|..:..|....:|.|:.|      
Mouse    62 Q-EPAPEAPKRRKRKPR-------AAEPQEPVEPKK----PATSKKSGKSTKSKEKQEKITDAFK 114

  Fly   762 ---KHDRFNGMSEEEVIKRTIPDHLCDNLDIVIVGINPGLFAAYKGHHYAGPGNHFWKCLYLAGL 823
               |.|||||:||.|::.:|:||.|..||||||:||||||.||||||||.||||||||||:::||
Mouse   115 VKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGL 179

  Fly   824 TQEQMSADEDHKLI-KQGIGFTNMVARATKGSADLTRKEIKEGSRILLEKLQRFRPKVAVFNGKL 887
            ::.|::...||.|. |.||||||||.|.|.||.||:.||.:||.|||::|||:::|::||||||.
Mouse   180 SEVQLNHMNDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKC 244

  Fly   888 IFEVFSGK------KEFHFGRQPDRVDGTDTFIWVMPSSSARCAQLPRAADKVPFYAALKKFRDF 946
            |:|:||.:      |...||.||.::..|:|..:|||||||||||.|||.|||.:|..||..||.
Mouse   245 IYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQ 309

  Fly   947 LNGQIPHIDESECVFTDQRIRLCSAQQQVDIVGKINKTHQP--------PLGDHPSSLTVVSNCS 1003
            |.|...:.|..|..:|   ..|..||:....:....:.:.|        ..|::|        |:
Mouse   310 LKGIERNADVQEVQYT---FDLQLAQEDAKKMAVKEEKYDPGYKAAYGGAYGENP--------CN 363

  Fly  1004 GPIAGDAECGIVAEES---------DQVQSEKMIPQMDPTVPSSSN 1040
            |...|.|..|:.|..:         |....:.|.......:||.:|
Mouse   364 GEPCGIASNGLTAHSAEPRGEAAPGDVPNGQWMAQSFAEQIPSFNN 409

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Thd1NP_001259060.1 UDG_like 714..962 CDD:294330 129/264 (49%)
Tdg-psXP_006521693.1 mug 2..340 CDD:273154 148/358 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003740
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.