DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Thd1 and tdg

Sequence 1:NP_001259060.1 Gene:Thd1 FlyBaseID:FBgn0026869 Length:1738 Species:Drosophila melanogaster
Sequence 2:NP_001004982.1 Gene:tdg XenbaseID:XB-GENE-1006128 Length:441 Species:Xenopus tropicalis

Alignment Length:505 Identity:175/506 (35%)
Similarity:235/506 (46%) Gaps:127/506 (25%)


  Fly   538 PENQDDGYETSAGDVLTPNSHSSSTHSIT--PQHQMQHSNIVLMTQNQKKSDDLQLTKVTLSGEA 600
            |.|.|.|.|            ..:.|.:|  |.|::|                      ..||.|
 Frog    30 PSNMDLGNE------------QQTLHPLTGVPAHELQ----------------------AFSGMA 60

  Fly   601 HTDPNACSSNSSQGQVLASQSHLELSEGTRCSSHASVVDPYSFMGEELHMHSPSHRHLDAVTTGP 665
            ..:|          |||.:.:.::..|..........:.|.....|.              |||.
 Frog    61 ANEP----------QVLHTLTGVQAQEPINGEMQVPEMIPNLAEAEP--------------TTGK 101

  Fly   666 GRYGILVSNDTPECLSREMYRHSQQSTTVLEQTDSSSCGINFKPMPKKRGRKKKLVAVNADTSQM 730
            .:.|...|...|:                 :|...|:      ..||..|:::|:    .||.  
 Frog   102 RKRGKAPSEPKPK-----------------KQAAKSA------KAPKSSGKQEKI----TDTF-- 137

  Fly   731 TTPVDQQKVSAGRADCEDGGGDQAAKPKERKKHDRFNGMSEEEVIKRTIPDHLCDNLDIVIVGIN 795
                                       |.::|.|||||:||.|::.:|:||.|..||||||:|||
 Frog   138 ---------------------------KVKRKVDRFNGVSEAELMTKTLPDILTFNLDIVIIGIN 175

  Fly   796 PGLFAAYKGHHYAGPGNHFWKCLYLAGLTQEQMSADEDHKL-IKQGIGFTNMVARATKGSADLTR 859
            |||.||||||||.||||||||||:|:||:..|::..:||.| .|.||||||||.|.|.||.||:.
 Frog   176 PGLMAAYKGHHYPGPGNHFWKCLFLSGLSDMQLNHLDDHSLPEKYGIGFTNMVERTTPGSKDLSS 240

  Fly   860 KEIKEGSRILLEKLQRFRPKVAVFNGKLIFEVFSGK------KEFHFGRQPDRVDGTDTFIWVMP 918
            ||.:||.||||||||:::|:||.||||.|:|:||.:      |:|.||.||.||..|||..:|||
 Frog   241 KEFREGGRILLEKLQKYKPRVAAFNGKCIYEIFSKEIFGVKIKKFEFGIQPHRVPETDTVCYVMP 305

  Fly   919 SSSARCAQLPRAADKVPFYAALKKFRDFLNGQIPHIDESECVFT-DQRIRLCSAQQQVDIVGKIN 982
            ||||||||.|||.|||..|..||:.|:.|.|.....:..|..:: |.::....|::|.....|.:
 Frog   306 SSSARCAQFPRAQDKVHHYIKLKELRNQLKGVESSREVQEVQYSFDLQLAQADAKRQAIKEEKYD 370

  Fly   983 KTHQPPLGDHPSSLTVVSNCSG--PIAGDAECGIVAEESDQVQSEKMIPQ 1030
            ..:....|:..:..| .|..||  ..:.||......|.:.|.|:.:.|||
 Frog   371 PGYNEATGEQFNEQT-TSGESGMCNFSTDATVSSNPEFNGQGQNGQWIPQ 419

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Thd1NP_001259060.1 UDG_like 714..962 CDD:294330 128/255 (50%)
tdgNP_001004982.1 UDG_like 2..364 CDD:320999 161/448 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C316589456
eggNOG 1 0.900 E1_COG3663
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003740
OrthoInspector 1 1.000 T1059700
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1493
TreeFam 1 0.960
65.820

Return to query results.
Submit another query.