DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Thd1 and thp1

Sequence 1:NP_001259060.1 Gene:Thd1 FlyBaseID:FBgn0026869 Length:1738 Species:Drosophila melanogaster
Sequence 2:NP_588515.1 Gene:thp1 PomBaseID:SPCC965.05c Length:325 Species:Schizosaccharomyces pombe

Alignment Length:302 Identity:88/303 (29%)
Similarity:148/303 (49%) Gaps:54/303 (18%)


  Fly   642 SFMGEELHMHSPSHRHLDAVTTGPGRYGILVSNDT---PECLSREMYRHS-----QQSTTVLEQT 698
            ||..|.|.:......     |:|    |||....|   .|.|.|..:.|:     .:.|.|::.:
pombe    31 SFDDENLELEESREE-----TSG----GILKKAKTQSFSESLERFRFAHAGSNNEYRKTDVVKNS 86

  Fly   699 DSSSCGINFKPMPKKRGRKKKLVAVNADTSQMTTPVDQQKVSAGRADCEDGGGDQAAKPKERKKH 763
            |:.: |:          .|..:..:..:.......|:..|.|..:|..:        |...:||:
pombe    87 DTDN-GL----------LKSAVETITLENGLRNRRVNVTKKSTLKASVK--------KSTLKKKN 132

  Fly   764 DRFNGMSEEEVIKRTIPDHLCDNLDIVIVGINPGLFAAYKGHHYAGPGNHFWKCLYLAGLTQ--E 826
            :      .:..:.:.:||::|:|...:|||:|||:.::.|||.:|.|.|.|||.|..:.|.:  .
pombe   133 E------VDPALLQGVPDYICENPYAIIVGLNPGITSSLKGHAFASPSNRFWKMLNKSKLLEGNA 191

  Fly   827 QMSADEDHKLIKQGIGFTNMVARATKGSADLTRKEIKEGSRILLEKLQRFRPKVAVF-NGKLIFE 890
            :.:...|..|...|:|.||:.||.:...|||.::|:::|:|||.||::|:||:|.:| :||.|:|
pombe   192 EFTYLNDKDLPAHGLGITNLCARPSSSGADLRKEEMQDGARILYEKVKRYRPQVGLFISGKGIWE 256

  Fly   891 ----VFSGK---KEFHFGRQPDRVDGTDTFIWVMPSSSARCA 925
                :.:||   |.|.||.||::....:.|:.:  |||.|.|
pombe   257 EMYKMLTGKKLPKTFVFGWQPEKFGDANVFVGI--SSSGRAA 296

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Thd1NP_001259060.1 UDG_like 714..962 CDD:294330 70/223 (31%)
thp1NP_588515.1 UDG_like 5..325 CDD:294330 88/303 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003740
OrthoInspector 1 1.000 T1125019
orthoMCL 1 0.900 OOG5_130139
Panther 1 1.100 LDO PTHR12159
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1493
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.