DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Thd1 and Tdg

Sequence 1:NP_001259060.1 Gene:Thd1 FlyBaseID:FBgn0026869 Length:1738 Species:Drosophila melanogaster
Sequence 2:NP_766140.2 Gene:Tdg MGIID:108247 Length:421 Species:Mus musculus

Alignment Length:451 Identity:168/452 (37%)
Similarity:232/452 (51%) Gaps:80/452 (18%)


  Fly   626 SEGTRCSSHASVVDPYSFMGEELHMHSPSHRHLDAVTTGPGRYGILVSNDTPECLSREMYRHSQQ 690
            :|..|..|...|...|||..:::....|:.    |||||                 :::...:..
Mouse     3 AEAARSYSLEQVQALYSFPFQQMMAEVPNM----AVTTG-----------------QQVPAVAPN 46

  Fly   691 STTVLEQTDSSSCGINFKP---MPKKRGRKKKLVAVNADTSQMTTPVDQQKVSAGRADCEDGGGD 752
            ..||.||.......:. :|   .||:|.||.:       .::...||:.:|    .|..:..|..
Mouse    47 MATVTEQQVPEDAPVQ-EPAPEAPKRRKRKPR-------AAEPQEPVEPKK----PATSKKSGKS 99

  Fly   753 QAAKPKERK---------KHDRFNGMSEEEVIKRTIPDHLCDNLDIVIVGINPGLFAAYKGHHYA 808
            ..:|.|:.|         |.|||||:||.|::.:|:||.|..||||||:||||||.||||||||.
Mouse   100 TKSKEKQEKITDAFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYP 164

  Fly   809 GPGNHFWKCLYLAGLTQEQMSADEDHKLI-KQGIGFTNMVARATKGSADLTRKEIKEGSRILLEK 872
            ||||||||||:::||::.|::..:||.|. |.||||||||.|.|.||.||:.||.:||.|||::|
Mouse   165 GPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQK 229

  Fly   873 LQRFRPKVAVFNGKLIFEVFSGK------KEFHFGRQPDRVDGTDTFIWVMPSSSARCAQLPRAA 931
            ||:::|::||||||.|:|:||.:      |...||.||.::..|:|..:|||||||||||.|||.
Mouse   230 LQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQ 294

  Fly   932 DKVPFYAALKKFRDFLNGQIPHIDESECVFTDQRIRLCSAQQQVDIVGKINKTHQP--------P 988
            |||.:|..||..||.|.|...:.|..|..:|   ..|..||:....:....:.:.|        .
Mouse   295 DKVHYYIKLKDLRDQLKGIERNADVQEVQYT---FDLQLAQEDAKKMAVKEEKYDPGYEAAYGGA 356

  Fly   989 LGDHPSSLTVVSNCSGPIAGDAECGIVAEE---------SDQVQSEKMIPQMDPTVPSSSN 1040
            .|::|        |:|...|.|..|:.|..         ||....:.|.......:||.:|
Mouse   357 YGENP--------CNGEPCGIASNGLTAHSAEPRGEAAPSDVPNGQWMAQSFAEQIPSFNN 409

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Thd1NP_001259060.1 UDG_like 714..962 CDD:294330 129/264 (49%)
TdgNP_766140.2 mug 2..340 CDD:273154 153/373 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C316586519
eggNOG 1 0.900 E1_COG3663
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003740
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130139
Panther 1 1.100 LDO PTHR12159
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1493
TreeFam 1 0.960
76.820

Return to query results.
Submit another query.