DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Thd1 and Tdg

Sequence 1:NP_001259060.1 Gene:Thd1 FlyBaseID:FBgn0026869 Length:1738 Species:Drosophila melanogaster
Sequence 2:NP_446181.1 Gene:Tdg RGDID:620959 Length:386 Species:Rattus norvegicus

Alignment Length:368 Identity:152/369 (41%)
Similarity:204/369 (55%) Gaps:55/369 (15%)


  Fly   711 PKKRGRKKKLVAVNADTSQMTTPVDQQKVSAGRADCEDGGGDQAAKPKERK---------KHDRF 766
            ||:|.||.:       .::...||:.:|.:|.:    ..|....:|.|:.|         |.|||
  Rat    30 PKRRKRKTR-------AAEAQDPVEPKKPAASK----KSGKSTKSKEKQEKITDTFKVKRKVDRF 83

  Fly   767 NGMSEEEVIKRTIPDHLCDNLDIVIVGINPGLFAAYKGHHYAGPGNHFWKCLYLAGLTQEQMSAD 831
            ||:||.|::.:|:||.|..||||||:||||||.||||||||.||||||||||:::||::.|:|..
  Rat    84 NGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLSHM 148

  Fly   832 EDHKLI-KQGIGFTNMVARATKGSADLTRKEIKEGSRILLEKLQRFRPKVAVFNGKLIFEVFSGK 895
            :||.|. |.||||||||.|.|.||.||:.||.:||.|||::|||:::|::||||||.|:|:||.:
  Rat   149 DDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKE 213

  Fly   896 ------KEFHFGRQPDRVDGTDTFIWVMPSSSARCAQLPRAADKVPFYAALKKFRDFLNGQIPHI 954
                  |...||.||.::..|:|..:|||||||||||.|||.|||.:|..||..||.|.|.....
  Rat   214 VFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERST 278

  Fly   955 DESECVFTDQRIRLCSAQQQVDIVGKINKTHQP--------PLGDHPSSLTVVSNCSGPIAGDAE 1011
            |..|..:|   ..|..||:.........:.:.|        ..|::|        |:|...|.|.
  Rat   279 DVQEVQYT---FDLQLAQEDAKRTAVKEEKYDPGYEAAYGGACGENP--------CNGEPCGFAS 332

  Fly  1012 CGIVAEE---------SDQVQSEKMIPQMDPTVPSSSNATDGK 1045
            .|:.|..         ||....:.|.......:||.:|...|:
  Rat   333 NGLTANSAELGGESAPSDVPNGQWMAQSFAEQIPSFNNCGTGE 375

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Thd1NP_001259060.1 UDG_like 714..962 CDD:294330 130/264 (49%)
TdgNP_446181.1 mug 1..301 CDD:273154 136/285 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C316587302
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003740
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12159
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.