DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and C34B2.3

DIOPT Version :10

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:NP_492794.2 Gene:C34B2.3 / 172964 WormBaseID:WBGene00016388 Length:351 Species:Caenorhabditis elegans


Alignment Length:119 Identity:31/119 - (26%)
Similarity:49/119 - (41%) Gaps:31/119 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PHFKHSPIRQLREFESSSENLLEPDDLDSPRNRTFFKKLRNAMKNRKLLQTKK--VWEEEEEEDK 73
            |..:|:    ||......|:.::..|.|          |||..::...||.:|  :..|||::.:
 Worm   344 PELQHN----LRLIVDLVEHEIQKIDRD----------LRNERESALSLQQEKEMLINEEEKQKR 394

  Fly    74 YFEEKPKHEPIDYSLDLTIRVN-GNVLRNRVSSLLTIR--DLKHLVHCQTNYPE 124
            :.|.      ::|..|...|:. .|...|.....|.||  ||      ||:||:
 Worm   395 HLEN------MEYIADEISRIELENTSGNLTLDSLAIRFEDL------QTSYPD 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919
C34B2.3NP_492794.2 STKc_TTBK 41..316 CDD:270919
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.