DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: bip2 and ing3

Sequence 1:NP_651923.2 Gene:bip2 FlyBaseID:FBgn0026262 Length:1406 Species:Drosophila melanogaster
Sequence 2:NP_001008672.1 Gene:ing3 XenbaseID:XB-GENE-972305 Length:417 Species:Xenopus tropicalis

Alignment Length:400 Identity:103/400 (26%)
Similarity:161/400 (40%) Gaps:77/400 (19%)


  Fly  1041 EPKMRKHHKKLKKVKEGKNKKKKEKKDKSKKADQIGLPSFKSDRKIKANDKRQKKEKKK-DKDKQ 1104
            :|:.|:  :::..:|:...|..::..:|.:.|:||   ....||.::..|:...|.|.: :.|..
 Frog    54 KPEWRE--EQMASIKKDYFKALEDADEKVQLANQI---YDLVDRHLRKLDQELAKFKMELEADNA 113

  Fly  1105 ILVHIPDDTEEFDKVPLANNDEPV----LKSSSM----TINPSL-GAATSGISPNQIPKLTLKLS 1160
            .:..|    .|...:.|....:||    :.|.|:    ..|||. .:.|..:|..:.....|   
 Frog   114 GITEI----LERRSLELDTPSQPVNNHHVHSHSLGEKRKHNPSSHHSTTDHVSEKKFKSEAL--- 171

  Fly  1161 GKSTLFSSSEKEMTDAGKLKQTTILSSENKKRERDNSPELARFSPLVTGPPKNKQSETLHLGNSS 1225
             .|||.|.:.||.| || .:.....||.|.....:.|..|..::           ..:|..|..:
 Frog   172 -LSTLTSDASKENT-AG-CRNNLSSSSTNNVYNVNASQPLTSYN-----------ISSLSTGAGA 222

  Fly  1226 TAVLPVPSPVAVRAVQLPVS-----QTSSNSAGWLSNPNN-----------SNTASSTLSASSVL 1274
            .|:    :..|.:|||....     :|||..|.:.:..||           |.|.||:..||:  
 Frog   223 GAI----TMAAAQAVQATAQMKEGRRTSSLKASYEAFKNNDFQLGISLSRDSATYSSSALAST-- 281

  Fly  1275 LPQQLMLAPHT-------IMNNFVPAMCNSTGTVSKSGL--CSSPPNTSEENANAMQIA-ESSRP 1329
            |.|.|..:..|       ..:|...|...|:.:.|.|.|  |||....:.|.::....| ..|..
 Frog   282 LTQTLTSSATTDSRSGRKSKSNNKSASQQSSSSSSSSSLSSCSSSSALAHELSHQQTAAIPESDT 346

  Fly  1330 SSYVD--AEGNRIWICPACGKVDDGSAMIGCDGCDA---WYHWICVGITFAPKDNDDWFCRVCVT 1389
            :|.||  .:.|....| .|.:|..|. |:|||..|.   |:|:.|||::.|||..  |:|..|..
 Frog   347 NSQVDWTYDPNEPRYC-ICNQVSYGE-MVGCDNQDCPIEWFHYGCVGLSEAPKGK--WYCPQCTA 407

  Fly  1390 KKRIHGSEKK 1399
            ..:..||..|
 Frog   408 AMKRRGSRHK 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bip2NP_651923.2 BTP 4..80 CDD:128846
PHD_TAF3 1342..1387 CDD:276997 19/48 (40%)
ing3NP_001008672.1 ING 3..102 CDD:315637 11/53 (21%)
PHD_ING3 361..405 CDD:277060 19/48 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.