DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: bip2 and ing-3

Sequence 1:NP_651923.2 Gene:bip2 FlyBaseID:FBgn0026262 Length:1406 Species:Drosophila melanogaster
Sequence 2:NP_496909.1 Gene:ing-3 WormBaseID:WBGene00013095 Length:490 Species:Caenorhabditis elegans

Alignment Length:464 Identity:94/465 (20%)
Similarity:157/465 (34%) Gaps:137/465 (29%)


  Fly  1040 LEPKMRKHHKKLKKVKE--GKNKKKKEKKDKSKKADQIGLPSFKSDRKIKANDKRQKKEKKKDKD 1102
            :|.::.::.:.:....|  |.|..::::|::.|...:    .|.:.| :.|..|....||.::..
 Worm    32 VESRLNRNREAINDFFERTGVNMPEEQRKERCKVLQE----EFSTIR-VLAQRKYLIAEKMQELL 91

  Fly  1103 KQILVHIPDDTEEFDKVPLANND---EPVLKSSSMTINPSLGAATSGISPNQIPKLTLKLSGKST 1164
            |:..||:..:...|.....|:|.   |.:.|..:..:...|.|       .:..|...::.|...
 Worm    92 KKYKVHLEKEKTTFQCEMEADNSGVTEMIEKRYTQHVESLLTA-------RKERKRRHRVGGGGG 149

  Fly  1165 LFSSSEKEMTDAGKLKQTTILSSENKKR-----------ERDNSPELARF-------SPLVTGPP 1211
            ...||.:..|.|    ...:||.|:|.:           ..|.|.|.|:.       ||...|.|
 Worm   150 GGGSSSRASTVA----SGPLLSKESKDKIQRILQEGVRLRMDLSDESAQSALSSAIPSPAPRGRP 210

  Fly  1212 KNKQSETLHLGNSSTAV------LPV-PSPVAVR---------AVQLPVSQTSSNSAG-----WL 1255
            .....:.|.|.:::..|      .|| |:|.|.|         .|.:|.:.:|..:.|     :.
 Worm   211 PKIAKDQLLLSSAAMVVASDDCLTPVPPTPTARRRSNTNALRGTVSIPSALSSMMNRGESTSRFS 275

  Fly  1256 SNPNN---SNTA---SSTLSASSVLLPQQLMLAPHTIMNNFVPAMCNSTGTVSKS---------- 1304
            .||:.   ||..   ||....:|:|:.......||.:::...|.:.||...||:|          
 Worm   276 PNPSERSWSNAGIDESSPTPTTSLLMTPTFSSGPHIVVSPTTPVLQNSAFVVSESRHGRTRKLTS 340

  Fly  1305 -----------------------------------------GLCSSPPNTSEENANAMQIAESSR 1328
                                                     ...|||.:...|...|.:..:...
 Worm   341 RVQEMFKETLQRQRNHGNSIIALQERMSAANLAAAAQHAHAPTSSSPQSPLPEIEGAAEDDDEEG 405

  Fly  1329 PSSYV------------DAEGNRIWICPACGKVDDGSAMIGCDG--CD-AWYHWICVGITFAPKD 1378
            ||..:            |.|....| | .|.:...|. |:.||.  |. .|:|:.|:|:...|  
 Worm   406 PSYRIKRSHPMMAPGSEDEEDEMHW-C-FCNEKSYGD-MVQCDNRHCTLRWFHYPCIGMVEPP-- 465

  Fly  1379 NDDWFCRVC 1387
            ...|:|..|
 Worm   466 TGKWYCPRC 474

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bip2NP_651923.2 BTP 4..80 CDD:128846
PHD_TAF3 1342..1387 CDD:276997 14/48 (29%)
ing-3NP_496909.1 ING 3..101 CDD:289749 15/74 (20%)
PHD_ING 430..474 CDD:276980 15/49 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.