| Sequence 1: | NP_651923.2 | Gene: | bip2 / 43793 | FlyBaseID: | FBgn0026262 | Length: | 1406 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001355624.1 | Gene: | Ing4 / 28019 | MGIID: | 107307 | Length: | 249 | Species: | Mus musculus |
| Alignment Length: | 270 | Identity: | 63/270 - (23%) |
|---|---|---|---|
| Similarity: | 93/270 - (34%) | Gaps: | 80/270 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1151 QIPKLTLKLSGKSTLFSSSEK-----EMTDA-GKLK-------QTTILSSEN-KKRERDNSPELA 1201
Fly 1202 RFSPLVTGPPKNKQSETLHLGNSSTAVLPVPSPVAVRAVQLPVSQTSSNSAGWLSNPNNSNTASS 1266
Fly 1267 TLSASSVLLPQQLMLAPHTIMNNFVPAMCNSTGTVSKSGLCSSPPNTSEENANAMQIAESSRPSS 1331
Fly 1332 YVD--AEGNRIWICPACGKVDDGSAMIGCDGCDA---WYHWICVGITFAPKDNDDWFCRVCVTKK 1391
Fly 1392 RIHGSEKKKR 1401 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| bip2 | NP_651923.2 | BTP | 4..80 | CDD:128846 | |
| PHD_TAF3 | 1342..1387 | CDD:276997 | 20/47 (43%) | ||
| Ing4 | NP_001355624.1 | TNG2 | 7..245 | CDD:227367 | 60/264 (23%) |
| ING_ING4 | 11..104 | CDD:341095 | 15/62 (24%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 115..163 | 9/58 (16%) | |||
| Bipartite nuclear localization signal. /evidence=ECO:0000250 | 127..148 | 3/20 (15%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5034 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||