DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bip2 and athp-3

DIOPT Version :9

Sequence 1:NP_651923.2 Gene:bip2 / 43793 FlyBaseID:FBgn0026262 Length:1406 Species:Drosophila melanogaster
Sequence 2:NP_503022.1 Gene:athp-3 / 178479 WormBaseID:WBGene00013799 Length:286 Species:Caenorhabditis elegans


Alignment Length:283 Identity:56/283 - (19%)
Similarity:100/283 - (35%) Gaps:30/283 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1114 EEFDKVPLANND---EPVLKSSSMTINPSLGAATSGISPNQIPKLTLKLSGKSTLFSSSEKEM-- 1173
            ||.|..||:..|   :.::::....::...|....|.|.||..:|...:..........:|::  
 Worm    23 EEDDDYPLSTIDMAVQALIRNPHHNVDYICGVMIFGGSKNQFNELLNPVVVAQMSKQRKQKKVPV 87

  Fly  1174 -TDAGKLKQTTILSSENKKRERDNSPE-LARFSPLVTGPPKN--KQSETLHLGNSSTAVLPVPSP 1234
             ..||:.|:......:....|:...|: :.:|.|...|.|..  |.|:       ..||:....|
 Worm    88 KNPAGEAKRGRGRPRKQSSEEKVQIPKVVVKFEPKKRGRPAGAAKWSQ-------EVAVVLQKQP 145

  Fly  1235 VAVRAVQLPVSQTSSNSAGWLSNPNNSNTASSTLSASSVLLPQQLMLAPHTIMNNFVPAMCNSTG 1299
            ...|...|.:::.       :....:....|...|....|:.|:.:............|...|..
 Worm   146 QRKRGRPLKIAKK-------IEPVFHQKKESKQNSEEKALIQQEAVKGEPKNRGRPCGAAERSRE 203

  Fly  1300 TVSKSGLCSSPPNTSEENANAMQIAESSRPSSYVDAEGNRIWICPACGKVDDGSAMIGCDGCDAW 1364
            .|.|  |...||   .:....::||::..|......:..::.:||.|.........: |..|..|
 Worm   204 VVKK--LQKQPP---RKRGRPLKIAKNMEPEINQKKDTKQVHVCPICTLASKNGTCL-CTKCQKW 262

  Fly  1365 YHWICVGITFAPKDNDDWFCRVC 1387
            .|..|.||. :.:.|..:.|:.|
 Worm   263 VHLKCTGIR-SKQWNSQFQCKNC 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bip2NP_651923.2 BTP 4..80 CDD:128846
PHD_TAF3 1342..1387 CDD:276997 12/44 (27%)
athp-3NP_503022.1 Asp-B-Hydro_N <81..241 CDD:191249 31/178 (17%)
PHD_TCF19_like 241..284 CDD:276992 12/44 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.