DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: bip2 and Taf3

Sequence 1:NP_651923.2 Gene:bip2 FlyBaseID:FBgn0026262 Length:1406 Species:Drosophila melanogaster
Sequence 2:NP_001258271.1 Gene:Taf3 RGDID:2324594 Length:930 Species:Rattus norvegicus

Alignment Length:1460 Identity:313/1461 (21%)
Similarity:469/1461 (32%) Gaps:587/1461 (40%)


  Fly     2 MADRYASDLALVVVAQITQTIGYSCTLSAPLELLQDILQKFVQEFARDMHRHMEHANRIEPNLKD 66
            |.:.|:..|..|.||||.|.:|:.....:...||.|:||:::|:..|..||:.|...|.:|.|.|
  Rat     1 MCESYSRSLLRVSVAQICQALGWDSVQLSACHLLTDVLQRYLQQLGRGCHRYSELYGRTDPILDD 65

  Fly    67 ARLSIKNLSINVQELLDYIGNVEPVGFIRDVPQFPIGKSVNMNFLKPGSAETLTRPVYIFEYLPP 131
            ...:.:.:.:|:.||.|||.|:|||.|...:|.||:.|:..:.|.:|||.:...|..||.:||||
  Rat    66 VGEAFQLMGVNLHELEDYIHNIEPVTFPHQIPSFPVSKNSVLQFPQPGSKDAEERKDYIPDYLPP 130

  Fly   132 MQDPELREIPADVQKEFSEKQEFCSKAEYSSTNAADKLGAKHIDSISPNTVINFRSNAFELDVGS 196
            :         ...|:|..|:|                                            
  Rat   131 I---------VSSQEEEEEEQ-------------------------------------------- 142

  Fly   197 SVREMSSVVMTTGGFISPAIEGKLPED-------IIPDIVEKFLGLDAPFSPTIIVNSLQKSPQL 254
                    |.|.||..:.|::..|.||       :|.|  |.|||.....||.:......|.|:|
  Rat   143 --------VPTDGGTSAEAMQVPLEEDDELEEEEVIND--ENFLGKRPLDSPEVEEMPSMKRPRL 197

  Fly   255 ALSDRD-------------KTVNPRKIIPSETKIFKQNAALLTSGHSESSIIYASNNHTMLTVTT 306
            ..|..|             .::||:||.|           :|:..|.:.|        |.|...:
  Rat   198 LNSKGDSLDVVLLEAREPLSSINPQKIPP-----------MLSPVHVQDS--------TDLAPPS 243

  Fly   307 PKKNRKQKHDLICEPGQSELLTNPFEKAQEKSQRKALKMYKQTSKNQRDSSINQIQNMKKLKKKF 371
            |            ||.    :..||.|:|.                                   
  Rat   244 P------------EPP----MLAPFAKSQL----------------------------------- 257

  Fly   372 NRGSFDPNKKHLE-KIFKKQSKLKQNDLQLDIDEKHFLQNSQTTSGLAIKANSNENALQADIPSQ 435
                  |..|.|| |.|..::|.|                   .|....|..|.:.||      .
  Rat   258 ------PIAKPLETKPFTPKTKTK-------------------ASSPGQKTKSPKAAL------S 291

  Fly   436 PPTVTSQIENNFRNSIYPVQPSVIQQTQVLLAEKKSGSEPERSKLDIFKKISKPRTPRPDIGATL 500
            |..:.|.|.:          |..|.:      ||||   |.|||        .|::|:.....|.
  Rat   292 PARLGSPIRS----------PKTIPK------EKKS---PGRSK--------SPKSPKSPKIVTH 329

  Fly   501 VP-----PGTGVSVFGSTMTPSALI-------SLPSGTTITPTPSLGLNSENKNVPSMKINPCNI 553
            ||     |.|      ...||||::       ::|...|.|| |..|                  
  Rat   330 VPQPPVRPET------PNRTPSAMVVEKTVKETIPVKPTQTP-PETG------------------ 369

  Fly   554 FDGTIPLTKAGVEMSIIDSPKPKKRGRKPGGKNVIKQTNVVSQPLINKVERKKSSQAITLPLSSS 618
                    |..:||.:       |:|             ||:...|:               .|.
  Rat   370 --------KLNIEMQL-------KKG-------------VVTDKTID---------------DSI 391

  Fly   619 PMIITQSSLNVSPPTEPLNLCN-TEQPSNNFLSNLYAKEKKDRKKYKSLPENVMQLDKSCSPEKA 682
            ..:|.::.....|  :|....: :|...:.|.|                |:.:..  ..|:..||
  Rat   392 DAVIARACAEREP--DPFEFSSGSESEGDTFTS----------------PKRISV--SECTTPKA 436

  Fly   683 STLHNSI-----RPTKQNNDVQCSDKFVT----ISNALSNASIYPGIQTGMVPLLPLLQFPPRPG 738
            ||..|:.     .|...:.....||...|    |...:..|.:  |..:.|.|..|.:.      
  Rat   437 STSSNNFTKSLATPLPLSGGTSSSDNSWTMDASIDEVVRKAKL--GAPSNMPPTFPYIS------ 493

  Fly   739 LIPTGPGLFPAVTGLVGFGNHGNRIPISPFIDYPGPE---ESVADTVRCPP---IKDSPVTDSDQ 797
                                       ||.|..|.||   :...:..:.||   :|.....:...
  Rat   494 ---------------------------SPSISPPTPEPLHKGYEEKAKPPPSVDVKKKLKKELKT 531

  Fly   798 FLSRSSTQTDLQMDRNYCNVAPLVPDSMKFAECKSVSCASTILENPSAQATSKINTKPLLEASGN 862
            .|.:...|.|.:.:|..........|.::..|           :...|....|...|.|::  ..
  Rat   532 KLKKKEKQRDRERERERNKEKSKEKDKVRERE-----------KEKEAGKEVKYPWKELMK--DE 583

  Fly   863 PDDP----IEVSDDSDESMHNRQMVQRKTPISSPTYVKTSFAELNPSSFTSAASNGEEKSKMDLR 923
            ..||    |:..:|.|..:..:..:.|:.            .|.:............||.|.:  
  Rat   584 ESDPYKFKIKEFEDIDAKVRLKDGIVRRE------------REKHKDKKKDRERGKREKDKRE-- 634

  Fly   924 NIVSLSSNEPLKKFKKLVKQSFPDVKSVPHTPASHSSFPQFNLPNFMGGDKFSLAGGADLIPLSR 988
                   .|.||:..:..|...|..:.|  .|....:.|.|             :..|..:|   
  Rat   635 -------RERLKEKSREDKIKAPPTQLV--LPPKEMALPLF-------------SPAAVRVP--- 674

  Fly   989 VSDSEYSSKIVPFSSLGGTIPNQIKISEEHNIFSTFSNYEDITITPTGLTSLEPKMRKHHKKLKK 1053
                   :.:..||.:   :|.::                           .|.|.:...|:.||
  Rat   675 -------AMLPAFSPM---LPEKL---------------------------FEEKEKPKEKERKK 702

  Fly  1054 VKEGKNKKKKEKKDKSKKADQIGLPSFKSDRKIKANDKRQKKEKKKDKDKQILVHIPDDTEEFDK 1118
            .|:.|.|||:::|:|.||            .|.|..:||::::::|:|::          .:.:|
  Rat   703 DKKEKKKKKEKEKEKEKK------------EKEKEKEKREREKREKEKER----------HKHEK 745

  Fly  1119 VPLANNDEPVLKSSSMTINPSLGAATSGISPNQIPKLTLKLSGKSTLFSSSEKEMTDAGKLKQTT 1183
            :.:    |||:.:.|..                ||:|||::.               ||:.|  .
  Rat   746 IKV----EPVIPAPSPV----------------IPRLTLRVG---------------AGQDK--I 773

  Fly  1184 ILSSENKKRERDNSPELARFSPLVTGPPKNKQSETLHLGNSSTAVLPVPSPVAVRAVQLPVSQTS 1248
            ::|......|...:|.|.|..   |.||                 .|||.||.|....||     
  Rat   774 VISKVVPAPEAKPAPSLNRPK---TPPP-----------------APVPIPVRVSPTPLP----- 813

  Fly  1249 SNSAGWLSNPNNSNTASSTLSASSVLLPQQLMLAPHTIMNNFVPAMCNSTGTVSKSGLCSSPPNT 1313
                             ..|.|.:.:.| .||.:|       .||:       |.:|...:|   
  Rat   814 -----------------PPLLAQAAVCP-ALMPSP-------APAL-------SAAGSAKAP--- 843

  Fly  1314 SEENANAMQIAESSRPSSYV--DAEGNRIWICPACGKVDDGSAMIGCDGCDAWYHWICVGITFAP 1376
                   ::...:...|:||  |..||:|||||.|.|.||||.|||||.||.||||.||||..||
  Rat   844 -------VRSVVTETVSTYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMAAP 901

  Fly  1377 KDNDDWFCRVCVTKKRIHGSEKKKRRNKKK 1406
            .:...|||..|..|.:   .:||.:|.|.:
  Rat   902 PEEMQWFCPKCANKIK---KDKKHKRRKHR 928

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bip2NP_651923.2 BTP 4..80 CDD:128846 24/76 (32%)
PHD_TAF3 1342..1387 CDD:276997 29/45 (64%)
Taf3NP_001258271.1 BTP 5..79 CDD:128846 24/74 (32%)
RSB_motif 596..>654 CDD:292910 12/79 (15%)
PHD_TAF3 867..912 CDD:276997 29/45 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C330965764
eggNOG 1 0.900 E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006197
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_133482
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
54.690

Return to query results.
Submit another query.