DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31998 and Prrt3

Sequence 1:NP_726548.1 Gene:CG31998 FlyBaseID:FBgn0051998 Length:1459 Species:Drosophila melanogaster
Sequence 2:NP_001296392.1 Gene:Prrt3 RGDID:1562419 Length:978 Species:Rattus norvegicus

Alignment Length:946 Identity:177/947 (19%)
Similarity:297/947 (31%) Gaps:289/947 (31%)


  Fly   217 TQRYHSSHQQHGVG-GRPKNYEL-----------------------DLERDHALP----TSAPNA 253
            :.|:..:.|.|..| .||.:..|                       ||:...||.    |..|::
  Rat    60 SSRHSGTPQAHAEGPKRPADSPLGPALHGPKVAPGVVQGERLLRADDLQLARALTSQGWTGPPDS 124

  Fly   254 DILKSNNNPTYPNP-NRHHSHDRDRHRNVVLHSSTPIPSIPNLLKKINGAQPPTIPMYPGDIPSY 317
            ..|.....|. |:| ...|              .|.:|:.|:.  ::..|...|....||.....
  Rat   125 QELLETEAPE-PHPMGAPH--------------LTLVPTTPSF--QLTVATLDTASQKPGGPAGQ 172

  Fly   318 SPP-------SRAFFTPPLPPEYQ-NPFADKP------TL----RGTNNEGLIAVNRRPIPPPSL 364
            .||       .....|..||..|| :|....|      ||    :|.:.:||....:.|     |
  Rat   173 QPPRDEGLMAKAKTHTQALPWGYQGSPHILVPETGAVRTLVLGKQGGHEQGLQEAVQGP-----L 232

  Fly   365 MPSQDRIPIRPPDLGSNNNDAVVNSMTDLNYAPSGMDAKHRLEENFAHGTVSDISGVERIKALNT 429
            :..||.   ..|::||.   ..|.:..::...|.             .||..|     |..|.:.
  Rat   233 LTQQDP---ATPEVGST---PPVEAPVEVKSTPE-------------PGTQLD-----RALARSL 273

  Fly   430 PARASGEEYLYEKASSAKGQG-SYEVDAIGPNKRQ-------------EVLP--------NIRRI 472
            |.    .|.|..:.|...|.| ::||.::||...|             .:.|        ::|..
  Rat   274 PL----PEGLPAEPSKKGGAGDTWEVSSLGPQPEQTDHHGGQDSPAPPPIPPAASDISDGHLRPA 334

  Fly   473 LGSKNGDIPAVLLKHVTQRPIITLRQPPSSPIVLIEKSTSNEEIIDADAPSVVSPNINHSKYHPG 537
            :.|.||..|      ::.:.:....:.|.:|...|....::.:..:.....:.:...:.::..||
  Rat   335 IASMNGVDP------ISPQRVRGAMEAPGTPKSFIPDLLNSAQAANGTESPMRALQPDEAEEWPG 393

  Fly   538 QLEYYENATAGTTPSAAAAIGDVSATSFSYATTNA-GQPGHTGKTTDAIRELGTGVPDQNPIGAA 601
            :.:.:..|.....||.:.. |.|..|     |..| |||.....:..::    ..:|..:|...|
  Rat   394 RPQSHPPAPPVQAPSTSRR-GLVKVT-----TQRALGQPPPPEPSASSM----VPIPASSPPANA 448

  Fly   602 AAATVHTTW-------AWAWNIHIYLSVVLFTILSVYSLYKLLTYNKLTHLFAQAYFVCINLILI 659
            .|..:.  |       :::|.:|:|...|||.:.::.:|..|..      ..|......:..:|:
  Rat   449 TAPPLR--WGPLRRVLSFSWELHVYGVGVLFLLPALLALVTLAA------ALAGPRLALVAAVLV 505

  Fly   660 MICI-LRIFFLCFDAYNVHGSFNLFTSELFLNLPSTFLTVAFSVLILFLFLKSLNHKNNRYSALI 723
            ::.. ||..::..|.|.......:....:..|||...|..|.:.|.|......|.      ..|.
  Rat   506 LVASGLRSAYMLTDPYGSQARLGVRAGLVLYNLPFPLLLTALAALTLLGLGAGLP------QPLQ 564

  Fly   724 RPLTVVVGCGVHVVLCITLHYVESYTLKNHHLYFQQQQQQQYFRRQQLYNQQGQPTATMSPSAIL 788
            :||.:.|...||                                           .|.:..:.:.
  Rat   565 KPLLLGVVAPVH-------------------------------------------GAGLLATDLF 586

  Fly   789 PPPPRVLTLICQIIYIFICLSLGLLYLYIYRILKRILRSKSQNYIHGYQNLSYAIHITIATALLF 853
            ...| ||.|:.|.:......|:.|..|.:.|  :|:|...     .|: :.|....:......|.
  Rat   587 STSP-VLNLLTQGLSCAWGASVALGTLCLCR--RRLLEGP-----RGW-DASPGPRLLAVAGSLG 642

  Fly   854 VLLAALQIFGAIYISCRHTSIVDVDWLQWGYQFSLRLIE------IAIITLMS-----------W 901
            :|.:.||:..::::...........|..||..|.|||:|      :|:..|.:           |
  Rat   643 LLASGLQLAASLWLYPGPGREGRFSWAWWGVHFWLRLLELTWALALALAALAATRPRPPTEHACW 707

  Fly   902 VAGL---------KTSVEHDSLSAVAGDVRMIGSGMGAYGQDGGTPNNAIREKHVGNGTGTHNSN 957
            ...|         |:.|.....:..||.     ||:|..|.|       |.:..:.|..|.....
  Rat   708 AKLLRLACPAPTGKSEVPERPNNCYAGP-----SGVGTGGLD-------ISKSLIRNAAGEGGLP 760

  Fly   958 VTNFFLPCTSSSSQEHFETDYPAVCNANTNLHTYTMRTGKLIYDDSYALNSMGPTTATTSNARPC 1022
            .|....|..|::|........|.:                       :..|:||..:.:      
  Rat   761 ATPGSGPWGSAASLGRGRPGGPGM-----------------------SRGSVGPAPSLS------ 796

  Fly  1023 EYQLQEPMYQRPYDTGSIGSTLNQQHQLNQMRFQEH 1058
            |..|:.|            |.:|....::...|:||
  Rat   797 ELDLRPP------------SPINLSRSIDAALFREH 820

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31998NP_726548.1 EXS 610..>724 CDD:296120 24/122 (20%)
Prrt3NP_001296392.1 PHA03247 <64..468 CDD:223021 91/472 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28K70
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.