DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31998 and Prrt4

Sequence 1:NP_726548.1 Gene:CG31998 FlyBaseID:FBgn0051998 Length:1459 Species:Drosophila melanogaster
Sequence 2:XP_017448273.1 Gene:Prrt4 RGDID:1559885 Length:978 Species:Rattus norvegicus

Alignment Length:949 Identity:182/950 (19%)
Similarity:297/950 (31%) Gaps:304/950 (32%)


  Fly   306 TIPMY------PGD-IPSYSPPSRAFFTP---PLPPEYQNPFADKPTLRGT--NNEGLIAVN--- 355
            |.|::      ||: :|.:. .:...|||   .||||..:|.:. ||.|.|  :...:..|.   
  Rat   171 TDPLWELLVGSPGNYVPEWG-SAEGSFTPWASSLPPESTSPLSG-PTKRPTAPSQPRMSTVTWAT 233

  Fly   356 --RRPIPPPSL-MPSQDRIPIR---------PPDLGSNNNDAVVNSMTDLNYAPSGMDAKHRLEE 408
              ....||.|. .|.|..:.::         .|.||..:          |...||          
  Rat   234 ALTATAPPTSAPRPRQSELELKFDVALRAGAAPTLGHRS----------LPLLPS---------- 278

  Fly   409 NFAHGTVSDISGVERIKALN------TPARASGEEYLYEKASSAKGQGSYEVDAIGPNKRQEV-- 465
              ...::::|:|  |:....      :|.|....:             ||:.....|:...||  
  Rat   279 --LRASLAEIAG--RLGPFGFFGTTLSPLRNFSSQ-------------SYQGTTAQPSFASEVSD 326

  Fly   466 LPNIRRILGSKNGDIPAVLLKHVTQRPIITLRQPPSSPIVLIEKSTSNEEIIDADAPSVVSPNIN 530
            .|.    |....|.:|                 ||     |:|:..|:...:|    ||.||:..
  Rat   327 FPG----LFGTTGSLP-----------------PP-----LLERKFSSPSPLD----SVASPSSA 361

  Fly   531 HSKYHPGQLEYYENATAGTTPSAAAAIGDVSATSFSYATTNAGQPG-HTGKTTDAIRELGTGVPD 594
            ..|..|.|    .:.|..|:..     .::|..||.   :.:.||| ..|..::......:|.|.
  Rat   362 SIKTTPVQ----HDPTVSTSDP-----DELSPASFG---SPSAQPGCEPGSCSEPELSDDSGQPP 414

  Fly   595 QNPIG------AAAAATVHTTWAWAWNIHIYLSVVLFTILSVYSLYKLLTYNKLTHLFAQAYFVC 653
            .:|:.      .|..|.....|..||..|:|.:..||.::::.:|..|          |...:.|
  Rat   415 ASPLPLFFLTLEADWAEARARWGLAWEAHVYGAGALFGLVALLALLSL----------ALLPWRC 469

  Fly   654 ---------INLILIMICILRIFFLCFDAYNVHGSFNLFTSELFLNLPSTFLTVAFSVLILFLFL 709
                     ::|:|:.....|.|.|.:|||............|..:||...|.....:..|.   
  Rat   470 PPGAPCLALLDLLLLSAGTTRAFPLFYDAYGHRDRLPALAWLLLQDLPLPCLAAGLGLACLL--- 531

  Fly   710 KSLNHKNNRYSALIRPLTVVVGCGVHVVLCITLHYVESYTLKNHHLYFQQQQQQQYFRRQQLYNQ 774
                        |.||.|.....|:..:|.:.|                                
  Rat   532 ------------LARPRTPRCPIGLAALLLLGL-------------------------------- 552

  Fly   775 QGQPTATMSPSAILPPPPRVLTLICQIIYIFICLSLGLLYLYIYRILKRILRSKSQNYIHGYQNL 839
             |...|....||: ..|.|.|.|..:.::.|:...|..|.|.:.....|..|:.:.....|::..
  Rat   553 -GLAAAAALGSAV-HRPLRPLRLASRGLHAFLAAFLSGLLLALSCWGGRRRRAGAPLGGSGFKGA 615

  Fly   840 SYAIHI---------------TIATALLFVLLA-ALQIFGAIY-ISCRHTSIVDVDWLQWGYQFS 887
            :....:               |...|..|.||: |||.:..:: :.....:.::..|..|.:|..
  Rat   616 TPVPQVRSPFAPRESWRRAARTAPVAGTFGLLSGALQGYEVLHALGYGGQTGLEGPWPWWAFQLG 680

  Fly   888 LRLIEIAI---ITLM---------------------------------SWVAGLKTSVEHDSL-S 915
            |||.|:.:   :.|:                                 .||.|::   :.:.| |
  Rat   681 LRLGEVGVALPLALLGLYPALCSPRVPRRCWAKLFRLSPGHAAPLLPGGWVPGIR---DKEPLGS 742

  Fly   916 AVA-GDVRMI------GSGMGAYGQDGGTPN-NAIREKHVGNGTGTHNSNVTNFFLPCTSSSSQE 972
            |:| ||..::      |.|.....|.|..|. ...|.....:...:.:|:.|..|.|.:..:.:.
  Rat   743 AIARGDAELLQLCALAGPGPDLLLQGGSCPGFEGARANTTQSPASSPSSDCTVDFRPPSPINLRR 807

  Fly   973 HFET-------------DYPAVCNANTNLHTY-TMRTGKLIYDDSYALNSMGPTTATTSN---AR 1020
            ..|.             ..||..:|.:.|..| |:..|          |..|...:..|.   ..
  Rat   808 SIEEALCSEALLAPGLFQGPAFGDALSGLGLYRTISLG----------NKTGAGPSEKSEKVPGS 862

  Fly  1021 PCEYQLQEPMYQRPYDTGSIGSTLNQQHQLNQMRFQEHP---------TYMSTDYMTDSGPDHYE 1076
            |...:|..|....|..:.|.||........:.|.....|         ..:|....::|.|    
  Rat   863 PAPPELPSPGAWPPGSSASSGSLCGLSRDSSSMLLCSSPDRPPRCPLVCVLSPPRPSESSP---- 923

  Fly  1077 NPNFSLHSTATEQ----KRRDYDQNEVSFNSNSGALQQQ 1111
                ||.::.:.|    ..||..::.....:....||:|
  Rat   924 ----SLPASGSYQALSPPSRDSPEHASELQAEEALLQEQ 958

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31998NP_726548.1 EXS 610..>724 CDD:296120 25/123 (20%)
Prrt4XP_017448273.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28K70
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005795
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR35578
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.