DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31998 and Prrt3

Sequence 1:NP_726548.1 Gene:CG31998 FlyBaseID:FBgn0051998 Length:1459 Species:Drosophila melanogaster
Sequence 2:NP_001276628.1 Gene:Prrt3 MGIID:2444810 Length:972 Species:Mus musculus

Alignment Length:981 Identity:180/982 (18%)
Similarity:294/982 (30%) Gaps:360/982 (37%)


  Fly   176 ERSVAAVLIKVAYGTTSTTKRSIPDTSYSLG----------------LTTVATPFLTTQRYHSSH 224
            ||.:.|..:::|...||......||:...|.                :||..:..|:.....::.
Mouse    98 ERLLRADDLQLARAFTSQGWTGPPDSQELLEPEAPEPHPVRAPRLTLVTTTPSSLLSAAILSTAS 162

  Fly   225 QQHG--VGGRP-KNYELDLERDHALPTSAPNADILKSNNNPTYPNPNRHHSHDRDRHRNVVLHSS 286
            |:.|  .|.:| :|.||.:.:.....|.|...|...|::.|.         .:.|..|.:|    
Mouse   163 QKPGGTAGQQPARNEELIMVKAETHITQASPWDFQGSSHTPV---------PETDAVRTLV---- 214

  Fly   287 TPIPSIPNLLKKING--------AQPPTI----PMYPGDIPSYSPPSRAFFTPPLPPEYQNPFAD 339
                     |.|..|        .|.|.:    |:.||  ...:||.:...||       .|.|.
Mouse   215 ---------LGKQGGHEQGFQEAVQGPLLTQQDPVVPG--VGSTPPVKVESTP-------EPGAQ 261

  Fly   340 KPTLRGTNNEGLIAVNRRPIPPPSLMPSQDRIPIRPPDLGSNNNDAVVN-----SMTDL------ 393
            .         .|..|...|:|        :.:|..||..|:.:...|.:     ..|||      
Mouse   262 L---------DLALVRSLPLP--------EGLPAEPPKTGAGDTWEVSSLGPQPEQTDLLGGQDS 309

  Fly   394 ----NYAPSGMDAKHRLEENFAHGTVSDISGVERIKALNTPARASGEEYLYEKASSAKGQGSYEV 454
                ...||..|.    .:......||.::|.:.|    :|.|.               :|:.| 
Mouse   310 PAPQPIPPSASDT----SDGHLRPAVSSLNGADPI----SPQRV---------------RGAME- 350

  Fly   455 DAIGPNKRQEVLPNIRRILGSKNGDIPAVLLKHVTQRPIITLRQPPSSPIVLIEKSTSNEEIIDA 519
               .|...:..:|::.....:.||          |:.|:..| ||                    
Mouse   351 ---APGTPKSFIPDLPNSAQAANG----------TESPVRAL-QP-------------------- 381

  Fly   520 DAPSVVSPNINHSKYHPGQLEYYENATAGTTPSAAAAIGDVSATSFSYATTNA-GQPGHTGKTTD 583
                      :.::..||:.:.:..|.....||.:.. |.|..|     |..| |||.....:..
Mouse   382 ----------DEAEDWPGRPQSHPPAPPVQAPSTSRR-GLVRVT-----TQRALGQPLPPEPSAS 430

  Fly   584 AIRELGTGVPDQNPIGAAAAATVHTTW-------AWAWNIHIYLSVVLF---TILSVYSLYKLLT 638
            :|    ..:|..:|...|.|..:.  |       :::|.:|:|...|||   .:|::.::...|.
Mouse   431 SI----VPIPASSPPANATAPPLR--WGPLRRVLSFSWELHVYGVGVLFLLPALLALVTVAAALA 489

  Fly   639 YNKLTHLFAQAYFVCINLILIMICILRIFFLCFDAYNVHGSFNLFTSELFLNLPSTFLTVAFSVL 703
            ..:|. |.|.|       ::::...||..::..|.|.......:....:..|||...|..|.:.|
Mouse   490 GPRLA-LVAAA-------LVLVASGLRSAYMLTDPYGSQARLGVRAGLVLYNLPFPLLLTALAAL 546

  Fly   704 ILFLFLKSLNHKNNRYSALIRPLTVVVGCGVHVVLCITLHYVESYTLKNHHLYFQQQQQQQYFRR 768
            .|......|.      ..|.:||.:.:...||                                 
Mouse   547 TLLGLGAGLP------QPLQKPLLLGIVAPVH--------------------------------- 572

  Fly   769 QQLYNQQGQPTATMSPSAILPPPPRVLTLICQIIYIFICLSLGLLYLYIYRILKRILRSKSQNYI 833
                     .|..::.......|  ||.|:.|.:......|:.|..|.:.|  :|:|...     
Mouse   573 ---------GTCLLATDLFSTSP--VLNLLTQGLSCAWGASVALGTLCLCR--RRLLEGP----- 619

  Fly   834 HGYQNLSYAIHITIATALLFVLLAALQIFGAIYISCRHTSIVDVDWLQWGYQFSLRLIE------ 892
            .|: :.|....:......|.:|.:.||:..::::...........|..||..|.|||:|      
Mouse   620 RGW-DASPGPRLLAVAGSLGLLASGLQLAASLWLYPGPGREGRFSWAWWGVHFWLRLLELTWALA 683

  Fly   893 IAIITLMS-----------WVAGL---------KTSVEHDSLSAVAGDVRMIGSGMGAYGQDGGT 937
            :|:..|.:           |...|         |:.|.....:..||.     ||:|..|.|   
Mouse   684 LALAALAATRPRPPTEHACWAKLLRLACPAPTGKSEVPERPNNCYAGP-----SGLGTGGLD--- 740

  Fly   938 PNNAIREKHVGNGTGTHNSNVTNFFLPCTSSSSQEHFETDYPAVCNANTNLHTYTMRTGKLIYDD 1002
                |.:..:.|..|...       ||.|..|                                 
Mouse   741 ----ISKSLIRNAAGEAG-------LPVTPGS--------------------------------- 761

  Fly  1003 SYALNSMGP--TTATTSNARPCEYQLQEPMYQRPYDTGSIG-------------STLNQQHQLNQ 1052
                   ||  :.|:....||...::..         ||:|             |.:|....::.
Mouse   762 -------GPWGSAASLGRGRPGGQRMSR---------GSVGPAPSLSELDLRPPSPINLSRSIDA 810

  Fly  1053 MRFQEH 1058
            ..|:||
Mouse   811 ALFREH 816

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31998NP_726548.1 EXS 610..>724 CDD:296120 26/124 (21%)
Prrt3NP_001276628.1 PHA03247 <64..464 CDD:223021 93/494 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28K70
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.