DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31998 and prrt4

Sequence 1:NP_726548.1 Gene:CG31998 FlyBaseID:FBgn0051998 Length:1459 Species:Drosophila melanogaster
Sequence 2:XP_017947853.1 Gene:prrt4 ID: Length:935 Species:Xenopus tropicalis

Alignment Length:1217 Identity:231/1218 (19%)
Similarity:388/1218 (32%) Gaps:437/1218 (36%)


  Fly   221 HSSHQQHGVGGRPKNYELD------LERDHALPTSAPNADILKSNNNPTYPNPNRHHSHDRDRHR 279
            :.:.|...:.|:.||..|.      |....:.||.||   :...:::||:.      .:.:|.| 
 Frog    22 YEAAQDKYLTGQNKNAVLHTPSVDFLVLTESTPTLAP---LWVQSSSPTFA------GYQKDEH- 76

  Fly   280 NVVLHSSTPIPSIPNLLKKINGA-----QPPTIPMYPGDIPSYSPPSRAFFTPPLPPEYQNPFAD 339
                     :...|.|.|.|..:     :.||    ..|:...||.|      .|.|.||...:|
 Frog    77 ---------VSQSPALDKNIMDSTQLLKESPT----SDDVSLQSPFS------ILTPAYQTTNSD 122

  Fly   340 KPTLRGTNNEGLIAVNRRPI---PPPSLMPSQDRIPIRPPDLGSNNNDAVVNSMTDLNY-APSGM 400
            :     ::|.|...|....|   |.|.|..:.|:                    |..:| ||   
 Frog   123 E-----SSNTGYQTVPELSISQWPTPGLDQTTDQ--------------------TQFSYTAP--- 159

  Fly   401 DAKHRLEENFAHGTVSDISGVERIKALNTPARASGEEYLYEKASSAKGQGSYEVDAI-------- 457
                    .|...||.:............|.:.|....:..:.:|....     ||:        
 Frog   160 --------QFTIATVQESKLNSNTSPFTIPVKESDSPTVTNRLNSLSSS-----DAVTFSLPLFW 211

  Fly   458 GPNKRQEVLPNIRRILGSKNGDIPAVL---LKHVTQRPIITLRQPPSSPIVLIEKSTSNEEIIDA 519
            ...|:.|   |...:|..|.|.|.:.:   :::|.:. ::|:      |..:|..||.:..:...
 Frog   212 TSTKQTE---NDTELLMGKGGLISSAMPTPVENVDEM-LVTV------PAYVISDSTQSNSMESL 266

  Fly   520 DAPSVVSPNINHSKYHP--GQLEYYENATAGTT------PSAAAAIGDVS--------------- 561
            :    :|...:.....|  |:...:..||.|.|      |.:..::.|.|               
 Frog   267 E----ISTETDRKPLDPMSGEPTKFPFATKGNTDPPGTQPGSQDSLADSSFLDCFQSEDCDSVTL 327

  Fly   562 ATSFSYATTNAGQPGHTGKTTDAIRELGTGVPDQNPIGAAAAATVHTTW-----AW--AWNIHIY 619
            :|:.|....|.  .||:..           :|.: ||    ..|:|:.|     .|  ||...:|
 Frog   328 STAPSKVENNL--YGHSSL-----------LPFR-PI----FITLHSDWNTSVADWGVAWEALVY 374

  Fly   620 LSVVLF---TILSVYSLYKLL-------TYNKLTHLFAQAYFVCINLILIMICILRIFFLCFDAY 674
            .||.||   .:||..||:.|:       .|..:.|||           ||.:...|.|.|.:|||
 Frog   375 GSVGLFGSVALLSFLSLFCLVFRCPSGGHYLAVLHLF-----------LIFVGSSRAFSLFYDAY 428

  Fly   675 NVHGSFNLFTSELFLNLPSTFLTVAFSVLILFLFLKSLNHKNNRYSALIRPLTVVVGCGVHVVLC 739
            .......:|.:.|...|....:|.:||  |:||.|.|.........:|:|             ||
 Frog   429 GHQEKLPVFIAILLHELAFPCMTTSFS--IVFLLLSSRCQMQRSTPSLLR-------------LC 478

  Fly   740 I-----TLHYVESYTLKNHHLYFQQQQQQQYFRRQQLYNQQGQPTATMSPSAILPPPP----RVL 795
            |     .||:|                                    :|..|::....    ..|
 Frog   479 ILSATAVLHFV------------------------------------VSAGAVVLVDVLQKFAFL 507

  Fly   796 TLICQIIYIFICLSLGLLYLYIYRILKRI-------LRSKSQ--NYIHG-----YQNLSYAIHIT 846
            .|:...:||.:.:.|.|.: :::..:.|:       |::.:.  .|..|     .::.|.|.||.
 Frog   508 LLVSHGVYITLAVLLSLSF-FVFCCIARVQTTQIYDLKNSAPPVEYSSGCPFANSKDWSRATHIV 571

  Fly   847 IATALLFVLLAALQIFGAIYISCRHTSIVDVDWLQWGYQFSLRLIEI-AIITLMSWVAGLKTSVE 910
            :..::..:|.|.||::..:|......|||...|..|.:|.|..|.|: |.:.|            
 Frog   572 VIASIFSLLNAVLQLYAMLYAMGYGGSIVFGPWTWWAFQLSSSLCEVGACLPL------------ 624

  Fly   911 HDSLSAVAGDVRMIGSGMGAYGQDGG-----------TPNNAIREKHVGNGTGTHNSNVTNFFLP 964
                 ||.|...:..|      .|.|           ||.:...:.::.......:|:.....|.
 Frog   625 -----AVVGTYPLFSS------NDIGRNNCWTKLFCLTPGHVTMKANILQANSQWSSSQHEKLLI 678

  Fly   965 CTS--SSSQEHFETDYPAVCNANTNLHTYT---MRTGK---LIYDDSYALNSMGPTTATTSNARP 1021
            |.:  .|..|.|.            |:|..   |..|:   |||:.:.:|...| .:...|:..|
 Frog   679 CDTIIRSDSEFFP------------LYTLVEKRMSLGEDISLIYNSTKSLEVQG-LSLHNSSKTP 730

  Fly  1022 CEYQLQEPM-----YQRPYDTGSIGSTLNQQHQLNQMRFQEHPTYMSTDYMTDSGPDHYENPNFS 1081
            ....:|...     :|.|       |.:|.:..:::..|.|...                 |...
 Frog   731 SFISVQVDSDSTVDFQPP-------SPINLRRSIDEALFSEALI-----------------PKSL 771

  Fly  1082 LHSTATEQKRRDYDQNEVSFNSNSGALQQQVELLQNNCYSEPLEQENKRYEFNIFERPVFKEKSV 1146
            .|.||..             :|.|..::...:|.:|                      :||||  
 Frog   772 FHGTALS-------------SSLSLTIKSTTQLEEN----------------------IFKEK-- 799

  Fly  1147 HNVQSNSECIQDRQKITNGRKKKFNGALDRHVFESKTHERRSSNSANSCSSSNLGGGGRFGSFNS 1211
                                      |.||.::.:           :||...:.|......:.|:
 Frog   800 --------------------------ASDRGLYRT-----------SSCMEMDTGFSATRPAANT 827

  Fly  1212 FERGYFNGVCKSGTISSIAKAGALGRTLESPIASAETQRIVANGSQTLGIPDKDRPQYYQRASGR 1276
                     |:.|.:||  .:..:.:..||  |::...::..:||..:.....|           
 Frog   828 ---------CRQGNLSS--PSSQIWKGKES--ATSSLYKVSQDGSSLVLCSSSD----------- 868

  Fly  1277 NSNLRSLESETELFKSMPIRENHLQQLPYGHNSEDEEDEEDDTISGN 1323
            |:|..:...|.:...|...:..:...||....|.|...:::.|:||:
 Frog   869 NANSSTYSYEKKQGCSQQSKGMYHTLLPPSQESLDMTTKKEHTLSGD 915

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31998NP_726548.1 EXS 610..>724 CDD:296120 38/131 (29%)
prrt4XP_017947853.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005795
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.