DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31998 and Prrt4

Sequence 1:NP_726548.1 Gene:CG31998 FlyBaseID:FBgn0051998 Length:1459 Species:Drosophila melanogaster
Sequence 2:NP_001094913.1 Gene:Prrt4 MGIID:2141677 Length:902 Species:Mus musculus

Alignment Length:949 Identity:178/950 (19%)
Similarity:293/950 (31%) Gaps:304/950 (32%)


  Fly   306 TIPMY------PGD-IPSYSPPSRAFFTP---PLPPEYQNPFA---DKPTLRGTNNEGLI----A 353
            |.|::      ||: :|.:. .:...|||   .||||..:..:   .:||.......|.:    |
Mouse    95 TDPLWELLVGSPGNYLPEWG-SAEGSFTPWASSLPPESTSRLSGPTKRPTAHSQPRMGTVTWATA 158

  Fly   354 VNRRPIPPPSLMPSQDRIPIR---------PPDLGSNNNDAVVNSMTDL-----NYAPSGMDAKH 404
            :.....|..:..|.|..:.::         .|.||..:...:.:....|     ...|.|     
Mouse   159 LTATAPPTSAPRPHQSELELKFDVALRAGAAPTLGHRSLPLLPSLRASLAEIAGRLGPFG----- 218

  Fly   405 RLEENFAHGTVSDISGVERIKALNTPARASGEEYLYEKASSAKGQGSYEVDAIGPNKRQEVLPNI 469
                 |...|||.:....|.....|.|..|   :.:|.:.|                     |.:
Mouse   219 -----FFGTTVSPLRNFSRQSYPGTTAHPS---FAFEVSDS---------------------PGL 254

  Fly   470 RRILGSKNGDIPAVLLKHVTQRPIITLRQPPSSPIVLIEKSTSNEEIIDADAPSVVSPNINHSKY 534
            ....||                     |.||     |:|:..|:..::|    ||.||:....|.
Mouse   255 FGTTGS---------------------RPPP-----LLERKFSSPSLLD----SVASPSSASVKT 289

  Fly   535 HPGQLEYYENATAGTT-PSAAAAIGDVSATSFSYATTNAG-QPGHTGKTTDAIRELGTGVPDQNP 597
            .|.|    ::.|..|: |.      ::|..||...:|..| :||...: .:.:.:||.  |..:|
Mouse   290 TPVQ----QDPTVSTSGPD------ELSPASFGNPSTQPGCEPGSCSE-PELLDDLGQ--PPASP 341

  Fly   598 IG------AAAAATVHTTWAWAWNIHIYLSVVLFTILSVYSLYKLLTYNKLTHLFAQAYFVC--- 653
            :.      .|..|.....|..||..|:|.:..||.::::.:|..|          |...:.|   
Mouse   342 LPLFFLTLEADWAEARARWGLAWEAHVYGAGALFGLVALLALLAL----------ALLPWRCPPG 396

  Fly   654 ------INLILIMICILRIFFLCFDAYNVHGSFNLFTSELFLNLPSTFLTVAFSVLILFLFLKSL 712
                  ::|:|:.....|.|.|.:|||............|..:||...|.....:..|.      
Mouse   397 APCLALLDLLLLSAGTTRAFPLFYDAYGHRDRLPTLVWLLLQDLPLPCLAAGLGLACLL------ 455

  Fly   713 NHKNNRYSALIRPLTVVVGCGVHVVLCITLHYVESYTLKNHHLYFQQQQQQQYFRRQQLYNQQGQ 777
                     |.||.|.....|:..:|.:.|                                 |.
Mouse   456 ---------LARPRTPRCPAGLAALLLLGL---------------------------------GL 478

  Fly   778 PTATMSPSAILPPPPRVLTLICQIIYIFICLSLGLLYLYIYRILKRILRSKSQNYIHGYQNLSYA 842
            ..|....||: ..|.|.|.|..:.::.|:...|..|.|.:.....|..|:.:.....|::..:..
Mouse   479 AAAAALGSAV-HRPLRPLRLASRGLHAFLAAFLSGLLLALSCWGGRRRRAGAPLGGAGFKGATPV 542

  Fly   843 IHI---------------TIATALLFVLLA-ALQIFGAIY-ISCRHTSIVDVDWLQWGYQFSLRL 890
            ..:               |...|..|.||: |||.:..:: :.....:.::..|..|.:|..|||
Mouse   543 PQVRSPFAPRESWRRAARTAPVAGTFGLLSGALQGYEVLHALGYGSQAGLEGPWPWWAFQLGLRL 607

  Fly   891 IEIAI---ITLM---------------------------------SWVAGL-----------KTS 908
            .|:.:   :.|:                                 .||.|:           :..
Mouse   608 GEVGVALPLALLGLYPALCSPRVPRRCWAKLFRLSPGHAAPLLPGGWVPGIPDKEPLGSAIARGD 672

  Fly   909 VEHDSLSAVAG---DVRMIGSGMGAYGQDGGTPNNAIREKHVGNGTGTHNSNVTNFFLPCTSSSS 970
            .|...|.|:||   |:.:.|.|...:...|..|..:.        ..:.:|:.|..|.|.:..:.
Mouse   673 AELLQLCALAGPGPDLLLQGGGCRGFEGAGANPTQST--------ASSPSSDCTVDFRPPSPINL 729

  Fly   971 QEHFET-------------DYPAVCNANTNLHTY-TMRTGKLIYDDSYALNSMGPTTATTS-NAR 1020
            :...|.             ..||...|...|..| |:..|..|        ..||:..:.: ...
Mouse   730 RRSIEEALCSEALLAPGLFQGPAFGEALPGLGLYRTISLGNKI--------GAGPSEKSENVPGS 786

  Fly  1021 PCEYQLQEPMYQRPYDTGSIGSTLNQQHQLNQMRFQEHP---------TYMSTDYMTDSGPDHYE 1076
            |...:|..|....|..:.|.||........:.|.....|         ..:|....::|.|    
Mouse   787 PAPPELPSPGAWPPGSSASSGSLCGLSRDSSSMLLCSSPDRPPRCPLVCVLSPPRPSESSP---- 847

  Fly  1077 NPNFSLHSTATEQ----KRRDYDQNEVSFNSNSGALQQQ 1111
                ||.::.:.|    ..||..::.....:....||:|
Mouse   848 ----SLPASGSYQALSPPSRDSPEHASELQAEEALLQEQ 882

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31998NP_726548.1 EXS 610..>724 CDD:296120 25/123 (20%)
Prrt4NP_001094913.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28K70
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005795
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR35578
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.