DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS3A and CYLD

DIOPT Version :10

Sequence 1:NP_524618.1 Gene:RpS3A / 43768 FlyBaseID:FBgn0017545 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_609371.2 Gene:CYLD / 34380 FlyBaseID:FBgn0032210 Length:639 Species:Drosophila melanogaster


Alignment Length:136 Identity:24/136 - (17%)
Similarity:48/136 - (35%) Gaps:62/136 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 RKTCYAQQSQVRKIRARMTDIITNEVSG-----ADLKQLVN------------------------ 189
            ||..:.:..:|.|:|..:..:  :.|||     .|.::.:|                        
  Fly   332 RKNVFVRSDRVMKLRELLDQL--SSVSGLTCEEKDPEEFLNSLLSQIMRVEPFLKLSSGQDSYFY 394

  Fly   190 --------KLALDSIAKDIEKSCQRIYPLHDVYIRKVK---VLKKPRF----------------D 227
                    ||.|.|:.:..|:|    :...|:.:::|.   :::.|||                |
  Fly   395 QLFVEKDEKLTLPSVQQLFEQS----FHSSDIKLKEVPSCFIIQMPRFGKNYKMYPRILPSQVLD 455

  Fly   228 VSKLLE 233
            |:.::|
  Fly   456 VTDIIE 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS3ANP_524618.1 Ribosomal_S3Ae 21..224 CDD:425987 18/109 (17%)
CYLDNP_609371.2 CAP_GLY 143..219 CDD:214997
Peptidase_C19N 276..631 CDD:239135 24/136 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.