DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rift and Slc52a3

DIOPT Version :8

Sequence 1:NP_651901.3 Gene:Rift / 43756 FlyBaseID:FBgn0039882 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001158291.1 Gene:Slc52a3 / 69698 MGIID:1916948 Length:460 Species:Mus musculus

Alignment Length:454 Identity:167/454 - (36%)
Similarity:252/454 - (55%) Gaps:45/454 - (9%)


  Fly    73 SWLVDVLAIFFGIGTWLGVNGTFIQLPLLVDEAPEGWSLPSYLSVMVQIGNLGPLLYTAIQKYSP 137
            ::|..:|...||:|:|:.:||.:::|||||.|.||.|.|||||:|::|:.|:||||.|.:.::.|
Mouse     2 AFLTHLLVCVFGMGSWVAINGLWVELPLLVTELPEAWYLPSYLTVVIQLANIGPLLVTLMHRFRP 66

  Fly   138 KKLNDGWTIHGVLLVGAISCLLTAFFYNQTASVAGTDHSLALFLLTCFTALNACTSSVLFMPYMG 202
            ..|::...|..:|.||..:|:|.||.:|.|:.:.|..||:|..:||.|.||..|||||.|:|:|.
Mouse    67 GCLSEVPVIFLILCVGTAACILLAFLWNVTSWIQGGQHSVAFIVLTFFLALVDCTSSVTFLPFMS 131

  Fly   203 RFKEQYMVTYFIGEGLSGLLPSVTALIQGIGESGDCVLVNVTESGEEVYALRKTP---------- 257
            :....|:.|:|||||||||||::.||:||   ||....|||||:........:||          
Mouse   132 QLPTYYLTTFFIGEGLSGLLPALVALVQG---SGITTCVNVTETPGTTLNTMETPITQGNLSPSL 193

  Fly   258 -------------PRFDTRVFFLILFALMVLAYVGYALLNSLPLARRE------YAQVTV----- 298
                         |||...:|||:|..|.....|.:.||...|..|:.      ::|||:     
Mouse   194 PSPSWHQESRYLAPRFSPLLFFLLLSFLTGCCLVAFFLLQRQPWGRQGSIEDLLHSQVTLHSIRP 258

  Fly   299 --SEGNKYV------YGEADNQPKAEKLSKGQYTYLLLLIGAISLFSNGMFGSIQSYSSAPYGSQ 355
              :|....:      .|:...:.....|...|..::..::..::..:||:..|:|:||..|||..
Mouse   259 RDTEDTSSLGAPVSSPGKGSVEASVASLRPAQLAFIYSVVAFVNALTNGVLPSVQTYSCLPYGPV 323

  Fly   356 AYHLAATLSVIANPVACFMAMFLHFTSLRIITVLSILAGLLTSYVFTTAALSPLPPLHDQTVGAV 420
            ||||:||||.:|:|:|||:.:||...||..:.||::|.....:|....||:||.|.|.....|.|
Mouse   324 AYHLSATLSSVASPLACFLPIFLPNRSLLFLGVLTVLGTGFGAYNMAMAAMSPCPVLQGHWGGEV 388

  Fly   421 LVVTAWTLLVGIVSYTKLGITTVMRAQGGQSLVWVGAITQLGSAIGAVAIFFAINYSDLFQAAE 484
            |:|.:|.|....:||.|:.:..::|.:...:|:|.||..||||.|||:.:|..:|...||.:|:
Mouse   389 LIVLSWVLFAACLSYVKVMLGVILRDRSRSALLWCGAAVQLGSLIGALLMFPLVNVLKLFSSAD 452

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RiftNP_651901.3 DUF1011 320..418 CDD:283816 37/97 (38%)
Slc52a3NP_001158291.1 DUF1011 289..386 CDD:283816 37/96 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C24277135
eggNOG 1 0.900 E1_KOG4255
Hieranoid 1 1.000
Homologene 1 1.000 H12324
Inparanoid 1 1.050 292 1.000 Inparanoid score I2748
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003077
OrthoInspector 1 1.000 T1083763
orthoMCL 1 0.900 OOG5_131745
Panther 1 1.100 O PTHR12929
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3974
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.