DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rift and Slc52a2

DIOPT Version :8

Sequence 1:NP_651901.3 Gene:Rift / 43756 FlyBaseID:FBgn0039882 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_083919.1 Gene:Slc52a2 / 52710 MGIID:1289288 Length:450 Species:Mus musculus

Alignment Length:422 Identity:160/422 - (37%)
Similarity:227/422 - (53%) Gaps:28/422 - (6%)


  Fly    75 LVDVLAIFFGIGTWLGVNGTFIQLPLLVDEAPEGWSLPSYLSVMVQIGNLGPLLYTAIQKYSPKK 139
            |..:|...||:|:|..|||.:::||::|.|.||||||||||||:|.:||||.||.|..::.:..|
Mouse    11 LTHLLVALFGMGSWAAVNGIWVELPVVVKELPEGWSLPSYLSVLVALGNLGLLLVTLWRRLARGK 75

  Fly   140 LNDGWTIHGVLLVGAISCLLTAFFYNQTASVAGTDHSLALFLLTCFTALNACTSSVLFMPYMGRF 204
             .:...|..|..:|.:...|.|..:|..|.|||..:|:|...|....||..|.|:|.|:|::...
Mouse    76 -GEQVPIRVVQGLGIVGTGLLASLWNHVAPVAGKPYSVAFLTLAFVLALACCASNVTFLPFLSHL 139

  Fly   205 KEQYMVTYFIGEGLSGLLPSVTALIQGIGESGDCVLV---NVTESGEEVYALRKTPPRFDTRVFF 266
            ...::.::|:|:|||.|||.|.||.||:|.. :|:.|   ..|....||..: ..|.||....||
Mouse   140 PPPFLRSFFLGQGLSALLPCVLALGQGVGRL-ECLHVPANRTTGPPIEVSPI-NFPERFSATTFF 202

  Fly   267 LILFALM---VLAYVGYALLNSLPLA------------------RREYAQVTVSEGNKYVYGEAD 310
            .:|.||:   ..|:.|..||...|.:                  ..|.....:.|....|.|...
Mouse   203 WVLTALLGTSAAAFQGLLLLLPSPTSEPTTGTGLRVETPGTEEEEEEEEASPLQEPPGQVAGIVS 267

  Fly   311 N-QPKAEKLSKGQYTYLLLLIGAISLFSNGMFGSIQSYSSAPYGSQAYHLAATLSVIANPVACFM 374
            : .|||.:|...:...||.|:...:..:||:..::||:|..|||..|||||..|...|||:|||:
Mouse   268 SPDPKAHQLFSSRSACLLGLLAITNALTNGVLPAVQSFSCLPYGRLAYHLAVVLGSCANPLACFL 332

  Fly   375 AMFLHFTSLRIITVLSILAGLLTSYVFTTAALSPLPPLHDQTVGAVLVVTAWTLLVGIVSYTKLG 439
            ||.:...||..:..||:|..||.||:.|.|||||.|||...:.|.||||.:|.|..|..||.|:.
Mouse   333 AMAVLCRSLAGLCGLSLLGMLLGSYLMTLAALSPCPPLVGTSAGVVLVVLSWVLCAGTFSYIKVA 397

  Fly   440 ITTVMRAQGGQSLVWVGAITQLGSAIGAVAIF 471
            |::::.:.|..:|:..|...|:||.:||||:|
Mouse   398 ISSMLHSGGRPALLAAGVAIQVGSLLGAVAMF 429

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RiftNP_651901.3 DUF1011 320..418 CDD:283816 43/97 (44%)
Slc52a2NP_083919.1 DUF1011 278..376 CDD:283816 43/97 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C24268047
eggNOG 1 0.900 E1_KOG4255
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I2748
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D356719at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12929
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3974
TreeFam 1 0.960
98.890

Return to query results.
Submit another query.