DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rift and slc52a1

DIOPT Version :8

Sequence 1:NP_651901.3 Gene:Rift / 43756 FlyBaseID:FBgn0039882 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001008671.1 Gene:slc52a1 / 493299 XenbaseID:XB-GENE-5786440 Length:438 Species:Xenopus tropicalis

Alignment Length:446 Identity:153/446 - (34%)
Similarity:245/446 - (54%) Gaps:45/446 - (10%)


  Fly    72 RSWLVDVLAIFFGIGTWLGVNGTFIQLPLLVDEAPEGWSLPSYLSVMVQIGNLGPLLYTAIQKYS 136
            |..|:.||...||:|:|:.||..:::||::|.|.||||:||::|:|::.:||:|||..|...::.
 Frog     6 RDLLMHVLVALFGMGSWVSVNSLWVELPVVVKELPEGWNLPAFLTVLIALGNIGPLAVTLSHRFC 70

  Fly   137 PK-KLNDGWTIHGVLLVGAISCLLTAFFYNQTASVAGTDHSLALFLLTCFTALNACTSSVLFMPY 200
            |. ::::.|.|..|..:..:|....|.|:::...|||.:.|:...||....||..|||:|.|:|:
 Frog    71 PPGRVSEPWLIRSVQALSLVSAGFLAGFWDRRVLVAGEERSVPYLLLGFLLALGCCTSNVTFLPF 135

  Fly   201 MGRFKEQYMVTYFIGEGLSGLLPSVTALIQGIGESGDCVLVNVTESG-----EEVYALRKTPPRF 260
            |..|.:|::.::|||:|||.|||.|.||.||:|.. :|      .:|     .|.:.|::   .|
 Frog   136 MYSFPQQFVRSFFIGQGLSALLPCVLALGQGVGRL-EC------RNGTWGNHSEPHYLQE---NF 190

  Fly   261 DTRVFFLILFALMVLAYVGYALLNSLPLARR----EYAQVTVSEGNKYVYGEADNQP-------- 313
            ....:|..||..:.::.:.:.||  |.|..|    |..:....:|:.   |..|:.|        
 Frog   191 PASSYFWGLFCFLGVSALAFLLL--LVLRGRNKEEEQGEGPTQQGDG---GSEDSYPLKSPEEEQ 250

  Fly   314 ---------KAEKLSKGQYTYLLLLIGAISLFSNGMFGSIQSYSSAPYGSQAYHLAATLSVIANP 369
                     :.::....:..|||.|:|..:..:||:..|:|:||..|||..||||:..||.||||
 Frog   251 PQEPPDASNRGQRFWTARNVYLLALLGLSNALTNGILPSVQTYSCLPYGPDAYHLSVVLSNIANP 315

  Fly   370 VACFMAMFLHFTSLRIITVLSILAGLLTSYVFTTAALSPLPPLHDQTVGAVLVVTAWTLLVGIVS 434
            .|||:||.....|..::.|:..:..:...|:...|||||.|||.....|.|||:..|||.:|::|
 Frog   316 AACFIAMCALCRSSLVLGVIMAVGMIFGGYLMFLAALSPCPPLVGSLAGVVLVILCWTLFLGLLS 380

  Fly   435 YTKLGITTVMRAQGGQSLVWVGAITQLGSAIGAVAIFFAINYSDLFQA---AESNC 487
            |.|:.|.:::...|..:|:|.||:.|:||.:||:.:|..::...|||:   .:.||
 Frog   381 YLKVVIGSLLHEAGHSALLWCGAVIQMGSLVGALLMFPMVSIYHLFQSGRDCQDNC 436

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RiftNP_651901.3 DUF1011 320..418 CDD:283816 40/97 (41%)
slc52a1NP_001008671.1 DUF1011 266..364 CDD:310675 40/97 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C24269274
eggNOG 1 0.900 E1_KOG4255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D356719at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.710

Return to query results.
Submit another query.