DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rift and zgc:91890

DIOPT Version :8

Sequence 1:NP_651901.3 Gene:Rift / 43756 FlyBaseID:FBgn0039882 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001002182.1 Gene:zgc:91890 / 431729 ZFINID:ZDB-GENE-040704-21 Length:452 Species:Danio rerio

Alignment Length:456 Identity:168/456 - (36%)
Similarity:261/456 - (57%) Gaps:56/456 - (12%)


  Fly    73 SWLVDVLAIFFGIGTWLGVNGTFIQLPLLVDEAPEGWSLPSYLSVMVQIGNLGPLLYTAIQKYSP 137
            |....|||..||||:|:.:||.:::|||:|...||||.|||||::::|:.|:|||..|.:.::.|
Zfish     2 SLFTHVLACLFGIGSWVAINGMWVELPLIVTAIPEGWLLPSYLTIIIQMANIGPLFITLMHRFRP 66

  Fly   138 KKLNDGWTIHGVLLVGAISCLLTAFFYNQTASVAGTDHSLALFLLTCFTALNACTSSVLFMPYMG 202
            ..|::...|:.::.||.::..|.||.:..|.:....:||.||..|:...::..|||||.|:|:|.
Zfish    67 GVLDERPVIYTIVAVGVVATFLLAFLWKHTLTFGDGEHSAALLSLSFLLSVVDCTSSVTFLPFMM 131

  Fly   203 RFKEQYMVTYFIGEGLSGLLPSVTALIQGIG--------ESGDCVLVNVTESGEEVYALRKTPPR 259
            |.:.||:.|||||||||||:|::.||:||:|        .:.:..|.|:::|..|.:   ..|..
Zfish   132 RLQPQYLTTYFIGEGLSGLVPALVALVQGVGVVHCKNASANANFSLGNISQSLLETH---YQPAN 193

  Fly   260 FDTRVFFLILFALMVLAYVGYALLNSLPLARREYAQVTVSEGNKYVYGEADNQPKAEKL------ 318
            |.|:.|||.|.|:|::....:.|||..|...||:         |.:.|..|:..:.||:      
Zfish   194 FSTQGFFLFLSAMMMVCLGAFLLLNLHPAVAREH---------KSMKGYIDDSRRVEKIDLSQSP 249

  Fly   319 -------------------------SKGQYT-----YLLLLIGAISLFSNGMFGSIQSYSSAPYG 353
                                     .||.|:     ::.:::..::..:|.:..|:||||..|||
Zfish   250 NDETPEQRPMLDFPEGSAIKQRSSFGKGTYSRTELVFIFVVLAWVNALTNAVLPSVQSYSCLPYG 314

  Fly   354 SQAYHLAATLSVIANPVACFMAMFLHFTSLRIITVLSILAGLLTSYVFTTAALSPLPPLHDQTVG 418
            :||||||||||.:|||||||:|||:...||.::.||::......:|:...|||||.|.|.:..:|
Zfish   315 NQAYHLAATLSSVANPVACFIAMFVPIRSLVLMGVLTVTGTGFGAYIMAMAALSPCPLLINDDLG 379

  Fly   419 AVLVVTAWTLLVGIVSYTKLGITTVMRAQGGQSLVWVGAITQLGSAIGAVAIFFAINYSDLFQAA 483
            |.|:|..|.:.|..:||.|:.|..::|.:|..:|||.||:.||||.:||:::|..|:...|||:.
Zfish   380 AALIVITWVIFVLSLSYVKVIIGVILRDEGHSALVWCGAVVQLGSMLGALSMFPLISVYRLFQSG 444

  Fly   484 E 484
            :
Zfish   445 D 445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RiftNP_651901.3 DUF1011 320..418 CDD:283816 44/102 (43%)
zgc:91890NP_001002182.1 DUF1011 281..379 CDD:283816 41/97 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C24276021
eggNOG 1 0.900 E1_KOG4255
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 308 1.000 Inparanoid score I2562
OMA 1 1.010
OrthoDB 1 1.010 D356719at33208
OrthoFinder 1 1.000 FOG0003077
OrthoInspector 1 1.000 T597244
orthoMCL 1 0.900 OOG5_131745
Panther 1 1.100 LDO PTHR12929
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3974
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.