DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rift and Slc52a2

DIOPT Version :8

Sequence 1:NP_651901.3 Gene:Rift / 43756 FlyBaseID:FBgn0039882 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001103140.1 Gene:Slc52a2 / 362942 RGDID:1560410 Length:450 Species:Rattus norvegicus

Alignment Length:443 Identity:154/444 (35%)
Similarity:235/444 (53%) Gaps:44/444 (10%)


  Fly    75 LVDVLAIFFGIGTWLGVNGTFIQLPLLVDEAPEGWSLPSYLSVMVQIGNLGPLLYTAIQKYSPKK 139
            |..:|...||:|:|:.|||.:::||::|.|.||||||||||||:|.:||||.||.|..::.:|.|
  Rat    11 LTHLLVALFGMGSWIAVNGIWVELPVVVKELPEGWSLPSYLSVLVALGNLGLLLVTLWRRLAPGK 75

  Fly   140 LN--DGWTIHGVLLVGAISCLLTAFFYNQTASVAGTDHSLALFLLTCFTALNACTSSVLFMPYMG 202
            ..  ....:.|:.:||.   .|.|..::..|.|||..||:|...|....||:.|.|:|.|:|::.
  Rat    76 SERIPIQVVQGLSIVGT---GLLAPLWSNMALVAGQLHSVAFLTLAFVLALSCCASNVTFLPFLS 137

  Fly   203 RFKEQYMVTYFIGEGLSGLLPSVTALIQGIGESGDCVLVNVTESGEEVYALRKT----PPRFDTR 263
            .....::.::|:|:|||.|||.|.||.||:|.. :|  ::|..:|.....::.:    |.||...
  Rat   138 HLPPPFLRSFFLGQGLSALLPCVLALAQGVGRL-EC--LHVPANGTTGPPIKVSPINFPERFSAG 199

  Fly   264 VFFLILFALM---VLAYVGYALLNSLPLARREYAQVTVSEGNKYVYGEADNQ------------- 312
            .||.:|.||:   ..|:.|..||  ||....|   .|:..|.:......:.:             
  Rat   200 TFFWVLTALLGTSAAAFQGLLLL--LPSPPPE---ATMGTGLRVETPGTEEEEEEEEASPLQEPP 259

  Fly   313 -----------PKAEKLSKGQYTYLLLLIGAISLFSNGMFGSIQSYSSAPYGSQAYHLAATLSVI 366
                       |||.:|...:...||.|:...:..:||:..::||:|..|||..|||||..|...
  Rat   260 GQVASIVSSPDPKAHRLFSSRSACLLGLLAITNALTNGVLPAVQSFSCLPYGRLAYHLAVVLGSS 324

  Fly   367 ANPVACFMAMFLHFTSLRIITVLSILAGLLTSYVFTTAALSPLPPLHDQTVGAVLVVTAWTLLVG 431
            |||:|||:||.:...||..:..|.:|.....:|:.|.|.|||.|||...:.|.||||.:|.|..|
  Rat   325 ANPLACFLAMAVLCRSLAGLYGLCLLGMFFGTYLMTLAVLSPCPPLVGTSAGVVLVVLSWVLCAG 389

  Fly   432 IVSYTKLGITTVMRAQGGQSLVWVGAITQLGSAIGAVAIFFAINYSDLFQAAE 484
            :.||.|:..::::.:.|..:|:..|...|:||.:||:|:|...:...:|::.|
  Rat   390 VFSYIKVATSSMLHSGGRPALLAAGVAIQVGSLLGAIAMFPPTSVYPVFRSGE 442

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RiftNP_651901.3 DUF1011 320..418 CDD:283816 38/98 (39%)
Slc52a2NP_001103140.1 DUF1011 278..376 CDD:283816 38/98 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C24271089
eggNOG 1 0.900 E1_KOG4255
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 290 1.000 Inparanoid score I2667
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D356719at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T618526
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12929
Phylome 1 0.910 0.857 Consistency score
TreeFam 1 0.960
98.860

Return to query results.
Submit another query.