DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rift and SLC52A3

DIOPT Version :8

Sequence 1:NP_651901.3 Gene:Rift / 43756 FlyBaseID:FBgn0039882 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001357014.1 Gene:SLC52A3 / 113278 HGNCID:16187 Length:469 Species:Homo sapiens

Alignment Length:469 Identity:171/470 (36%)
Similarity:246/470 (52%) Gaps:66/470 (14%)


  Fly    73 SWLVDVLAIFFGIGTWLGVNGTFIQLPLLVDEAPEGWSLPSYLSVMVQIGNLGPLLYTAIQKYSP 137
            ::|:.:|...||:|:|:.:||.:::|||||.|.||||.|||||:|::|:.|:||||.|.:..:.|
Human     2 AFLMHLLVCVFGMGSWVTINGLWVELPLLVMELPEGWYLPSYLTVVIQLANIGPLLVTLLHHFRP 66

  Fly   138 KKLNDGWTIHGVLLVGAISCLLTAFFYNQTASVAGTDHSLALFLLTCFTALNACTSSVLFMPYMG 202
            ..|::...|..:|.||.::|::.||.:|.|:.|....||:|..:||.|.||..|||||.|:|:|.
Human    67 SCLSEVPIIFTLLGVGTVTCIIFAFLWNMTSWVLDGHHSIAFLVLTFFLALVDCTSSVTFLPFMS 131

  Fly   203 RFKEQYMVTYFIGEGLSGLLPSVTALIQGIGESGDCVLVNVTESGEE------------------ 249
            |....|:.|:|:|||||||||::.||.||   ||....|||||..:.                  
Human   132 RLPTYYLTTFFVGEGLSGLLPALVALAQG---SGLTTCVNVTEISDSVPSPVPTRETDIAQGVPR 193

  Fly   250 --VYAL------------RKTPPRFDTRVFFLILFALMVLAYVGYALLNSLP------------- 287
              |.||            |..|..|...||||:|..:|....|.:.:|...|             
Human   194 ALVSALPGMEAPLSHLESRYLPAHFSPLVFFLLLSIMMACCLVAFFVLQRQPRCWEASVEDLLND 258

  Fly   288 ------LARRE------YAQVTVSEGNKYVYGEADNQPKAEKLSKGQYTYLLLLIGAISLFSNGM 340
                  :..||      ...|..|:|..|:      :.||.........::..|:..::..:|||
Human   259 QVTLHSIRPREENDLGPAGTVDSSQGQGYL------EEKAAPCCPAHLAFIYTLVAFVNALTNGM 317

  Fly   341 FGSIQSYSSAPYGSQAYHLAATLSVIANPVACFMAMFLHFTSLRIITVLSILAGLLTSYVFTTAA 405
            ..|:|:||...||..|||||||||::|||:|..::|||...||..:.|||:|......|....|.
Human   318 LPSVQTYSCLSYGPVAYHLAATLSIVANPLASLVSMFLPNRSLLFLGVLSVLGTCFGGYNMAMAV 382

  Fly   406 LSPLPPLHDQTVGAVLVVTAWTLLVGIVSYTKLGITTVMRAQGGQSLVWVGAITQLGSAIGAVAI 470
            :||.|.|.....|.||:|.:|.|..|.:||.|:.:..|:|.....:|:|.||..||||.:||:.:
Human   383 MSPCPLLQGHWGGEVLIVASWVLFSGCLSYVKVMLGVVLRDLSRSALLWCGAAVQLGSLLGALLM 447

  Fly   471 FFAINYSDLFQAAE 484
            |..:|...||.:|:
Human   448 FPLVNVLRLFSSAD 461

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RiftNP_651901.3 DUF1011 320..418 CDD:283816 38/98 (39%)
SLC52A3NP_001357014.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C24277979
eggNOG 1 0.900 E1_KOG4255
Hieranoid 1 1.000
Homologene 1 1.000 H12324
Inparanoid 1 1.050 283 1.000 Inparanoid score I2832
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D356719at33208
OrthoFinder 1 1.000 FOG0003077
OrthoInspector 1 1.000 T1073681
orthoMCL 1 0.900 OOG5_131745
Panther 1 1.100 O PTHR12929
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3974
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.