DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: faf and USP34

Sequence 1:NP_524612.2 Gene:faf FlyBaseID:FBgn0005632 Length:2778 Species:Drosophila melanogaster
Sequence 2:NP_055524.3 Gene:USP34 HGNCID:20066 Length:3546 Species:Homo sapiens

Alignment Length:2841 Identity:571/2842 (20%)
Similarity:935/2842 (33%) Gaps:1004/2842 (35%)


  Fly     7 RHTTGQPGSTAPSSSSSTTSTTTTTTSPAQSAGS---------------------------GSGI 44
            |.|...|.|.|.|..||..|.|      .||.||                           ||..
Human   508 RRTAPSPWSPAASPQSSDNSDT------HQSGGSDIEMDEQLINRTKHVQQRLSDTEESMQGSSD 566

  Fly    45 GTGTGTVANSSLPGGGSGSLDGNQDQ-----------QPATDSQSSD--DVAASLSANSVDSTIT 96
            .|.......||.||..||..||:.::           .|.::.||.|  |:.| |.....|....
Human   567 ETANSGEDGSSGPGSSSGHSDGSSNEVNSSHASQSAGSPGSEVQSEDIADIEA-LKEEDEDDDHG 630

  Fly    97 IVPPEKLISSFPTTKLRSLTQKISNPRWVVPVLPEQELEVLLNAAIELTQAGVD-HDCEPCVEFY 160
            ..||:    |...|.||:                 ::||         :|||:. .|.:...|  
Human   631 HNPPK----SSCGTDLRN-----------------RKLE---------SQAGICLGDSQGMSE-- 663

  Fly   161 RNGLSTSFAK--ILTDEAVNSWKNNIHHCILVSCGKLLHLIAIHMQRDNPYLLDLLAIVFDPENK 223
            |||.|:...|  :...|::.|..|.:.                        :||..:...|||:.
Human   664 RNGTSSGTGKDLVFNTESLPSVDNRMR------------------------MLDACSHSEDPEHD 704

  Fly   224 FN-TFNA-----GRQPECFAAPDYIWGQLDSNKMYARPPPEPKNAR------------------- 263
            .: ..||     |.|..|........|:...|:::        |.|                   
Human   705 ISGEMNATHIAQGSQESCITRTGDFLGETIGNELF--------NCRQFIGPQHHHHHHHHHHHHD 761

  Fly   264 GWLVDLINRFGQLGGFDNLLERFNIGLELLKRNQNKCTGKNISVEGRVENGAQDNRLTLALIHSL 328
            |.:||                      ::|..:...|:...:|.:.  |....|           
Human   762 GHMVD----------------------DMLSADDVSCSSSQVSAKS--EKNMAD----------- 791

  Fly   329 LRPFGQCYELLMPATIAKYFMPTWNVVLDLLDSFTDEELKREVKPEGRNDYINGIVKSARLLASR 393
                                             |..||                           
Human   792 ---------------------------------FDGEE--------------------------- 796

  Fly   394 LTGQEELIRDLEMFRLKMILRLLQVSSFNGKMNALNEINKVLSSVAYFSHRSQ-PL--PHCMPED 455
             :|.||              .|:|::|.....:.|.:....|:|: |..|.|| |:  .|....:
Human   797 -SGCEE--------------ELVQINSHAELTSHLQQHLPNLASI-YHEHLSQGPVVHKHQFNSN 845

  Fly   456 EMDWLTADRMAQWIKSSDVLGVVLKDSLHQPQYVEKLEKIIRFLIKEQALTLDDLDAVWRAQAGK 520
            .:..:..|.:.:  |.:.:|..:::|                    |.|:.|.            
Human   846 AVTDINLDNVCK--KGNTLLWDIVQD--------------------EDAVNLS------------ 876

  Fly   521 HEAIVKNVHDLLAKLAWDFTPEQLDHLFEAFQASMTTANKRQRERLLELIRRLAEDDKNGVMAQK 585
             |.::.....||..|...||..|:                  |.|.:|.......::::.|::.:
Human   877 -EGLINEAEKLLCSLVCWFTDRQI------------------RMRFIEGCLENLGNNRSVVISLR 922

  Fly   586 VL-KLFWTLAHSQEVPPEVLDQALGAHVKILDYSCSQERDAQKTIWLDKCVDELKSGDGWVLPAL 649
            :| |||.|.            |..|:              :..|.|:..          |.    
Human   923 LLPKLFGTF------------QQFGS--------------SYDTHWITM----------WA---- 947

  Fly   650 RLIRDICCLYDTTTNHAQRTQTSTNRQQVIERLQNDYSLVILVTNSLTAYMEKVRQMVTDSPGLD 714
                                             :.:.:::.|..::|..|::.||          
Human   948 ---------------------------------EKELNMMKLFFDNLVYYIQTVR---------- 969

  Fly   715 ATRILIDGR-----FPHHVQIAERLEFL----KFLLKDGQLWLCADQAKQIWHCLAVNAVFPADR 770
                  :||     :.|..::..||:||    ..|.......|..:|...:||||       .:.
Human   970 ------EGRQKHALYSHSAEVQVRLQFLTCVFSTLGSPDHFRLSLEQVDILWHCL-------VED 1021

  Fly   771 EECF----RWFGKLMGEEPDLDPGIN--KDFFENNILQLDPHLLTESGIKCFE---RFFKAVNSK 826
            .||:    .||...:..:.....|:.  |..|...:.||.|..::.:|:..|:   ...:...|.
Human  1022 SECYDDALHWFLNQVRSKDQHAMGMETYKHLFLEKMPQLKPETISMTGLNLFQHLCNLARLATSA 1086

  Fly   827 EDKLKAIHRGYMLDNEDLIGKDYLWRV-ITTGGEEIASKAIDLLKEV----STALGPRLQENIAE 886
            .|.         ..|.:|.|.|..|.: :.....:::..||..:...    .|.|         |
Human  1087 YDG---------CSNSELCGMDQFWGIALRAQSGDVSRAAIQYINSYYINGKTGL---------E 1133

  Fly   887 FHEMFIGECCSRLRTHYGNIVILGKTQLQEELDAPDQSDNTNDESKDSKMRFIEAEKMCRILKVL 951
            ..:.||.:|...|        ::..:.|::|              ..|.:..||     |.|.:|
Human  1134 KEQEFISKCMESL--------MIASSSLEQE--------------SHSSLMVIE-----RGLLML 1171

  Fly   952 QEYVKECDRSFS--------------------GDRVHLPLSRVTR-----GKNTI-LYIRFQNPG 990
            :.:::...|.|:                    .|:..|||..|.:     .|.|| :|     |.
Human  1172 KTHLEAFRRRFAYHLRQWQIEGTGISSHLKALSDKQSLPLRVVCQPAGLPDKMTIEMY-----PS 1231

  Fly   991 RSIDDMEI-VTHSNETMAAFKRNLLKRIKGTSTANIK----------VDLFYANDEMIGVSDEIN 1044
            ..:.|:.. |||..|.:...:.|...:::....:|.|          |.:..:..|:....|| .
Human  1232 DQVADLRAEVTHWYENLQKEQINQQAQLQEFGQSNRKGEFPGGLMGPVRMISSGHELTTDYDE-K 1295

  Fly  1045 PLYQYTIRDKMNLTAKLTPVGTGLASSPDSSSDSSTGSPPRPC-PDMQRVESESTLPGVIISQNY 1108
            .|::...:|...:...|        .:|...........|..| |..|:    ..:|.:::.|..
Human  1296 ALHELGFKDMQMVFVSL--------GAPRRERKGEGVQLPASCLPPPQK----DNIPMLLLLQEP 1348

  Fly  1109 QYTEFFLKLYQLGS-----------DLEHGRLRD--------SAKV--LLHLLP-C--------- 1142
            ..|..|..|..|.|           |.|..|..:        |.:|  ||.||| |         
Human  1349 HLTTLFDLLEMLASFKPPSGKVAVDDSESLRCEELHLHAENLSRRVWELLMLLPTCPNMLMAFQN 1413

  Fly  1143 --DRQT--------IRQLKIMCKVPKAAVTVAVTGDKIAKDEEEK------LYPTEQAGIEDEEE 1191
              |.|:        :.::|...|:..|...:...|....:...|.      |||......||:.|
Human  1414 ISDEQSNDGFNWKELLKIKSAHKLLYALEIIEALGKPNRRIRRESTGSYSDLYPDSDDSSEDQVE 1478

  Fly  1192 H------CTPEQMFLHPTPAQVLYNLSVLH-GLLIPALDPLGESALLVQSAW--MHSGCAHFVLE 1247
            :      |    .|:.....|.|  |.:.: |:|.|.          .|.:|  ....|...:|:
Human  1479 NSKNSWSC----KFVAAGGLQQL--LEIFNSGILEPK----------EQESWTVWQLDCLACLLK 1527

  Fly  1248 LLTKNNFLPS---------------ADMHTKR-------------ASFQCVLRLAKLFLYIVGSV 1284
            |:.:....||               |:.|.||             |....:.||.::||.:|   
Human  1528 LICQFAVDPSDLDLAYHDVFAWSGIAESHRKRTWPGKSRKAAGDHAKGLHIPRLTEVFLVLV--- 1589

  Fly  1285 LSRVGDEPMICDLDNGSRSQVDILKQNFSTMPSSSQGTLRAISAKLAVILAREMLSASPEGDRC- 1348
                                               |||          .|.:.::|.:...|.. 
Human  1590 -----------------------------------QGT----------SLIQRLMSVAYTYDNLA 1609

  Fly  1349 -RTLFSSTLQWSCPDISTIKAVVQLAWASSCGNLQALGNSSGDFEDEVIVPDGQDFSMCKEALEV 1412
             |.|.:.:...|..::|.....:.::||..|                         |:.|.:|  
Human  1610 PRVLKAQSDHRSRHEVSHYSMWLLVSWAHCC-------------------------SLVKSSL-- 1647

  Fly  1413 LTISFILNPSANEALTSD--PNWPKFITSIVLKNPLRHVRQVASEQLFLASTYCAGD--RRPFVY 1473
                          ..||  .:|.|.:|.::.:..:||.......:|.| |....||  .|.|:.
Human  1648 --------------ADSDHLQDWLKKLTLLIPETAVRHESCSGLYKLSL-SGLDGGDSINRSFLL 1697

  Fly  1474 MV--NLL-----VGALKTL-VPQYEST------CAEFFSVLCRTLSYGCIYNWPLQISEGL---- 1520
            :.  .||     ..|||.: :..||..      |.|:|.:||:.:.       .:.|.:..    
Human  1698 LAASTLLKFLPDAQALKPIRIDDYEEEPILKPGCKEYFWLLCKLVD-------NIHIKDASQTTL 1755

  Fly  1521 ---------LGDEIKWLQRIRENV-HATGDTQVHEELLEGHLCLAKELM-----FFLGADSKAQL 1570
                     |.|.|    |.||.: |..|:  |.::.|.|.|.||..::     |....:.:..|
Human  1756 LDLDALARHLADCI----RSREILDHQDGN--VEDDGLTGLLRLATSVVKHKPPFKFSREGQEFL 1814

  Fly  1571 NELIHELIDDFLFTASREFLHLRRHGSLRQDTVPPPVCRSPHTIAAACDLLIALCQLCVPNMKLL 1635
            .::.:.|   ||..:.::          ||.    |.|:|..:.|||.|||:.:.:..|.|.:|:
Human  1815 RDIFNLL---FLLPSLKD----------RQQ----PKCKSHSSRAAAYDLLVEMVKGSVENYRLI 1862

  Fly  1636 TNTLIDFVCTDTDPLREWDYLPPVGARPTKGFCGLKNAGATCYMNSVLQQLYMVPAVRVGILRAH 1700
            .|.::........|.: |||.|....|....|.||.|.|||||:.|.:|||||:|..|       
Human  1863 HNWVMAQHMQSHAPYK-WDYWPHEDVRAECRFVGLTNLGATCYLASTIQQLYMIPEAR------- 1919

  Fly  1701 GAATTDGEDFSGDSDLTGGGLGSALFSGPASALVSLPSSSSTIEDGLHDVRKNYHVVILKHVQAI 1765
                                  .|:|:...|                .|::   |...|..:|.:
Human  1920 ----------------------QAVFTAKYS----------------EDMK---HKTTLLELQKM 1943

  Fly  1766 FAHLGHSALQYYVPRGLWTHFKLLGEPVNLREQQDAVEFFMSLLESLDEGLKALGQPQLMN---A 1827
            |.:|..|..:.|.||.....:.:..:|:|..||:|..|||..|:..::|     ..|:|.|   :
Human  1944 FTYLMESECKAYNPRPFCKTYTMDKQPLNTGEQKDMTEFFTDLITKIEE-----MSPELKNTVKS 2003

  Fly  1828 TLGGSFSDQKICQECPHRYSKEEPFSVFSVDIRNHSSLTESLEQYVKGELLEGADAYHCDKCDKK 1892
            ..||..::..:..:|.|.....|.|......:.:..::.|||::....:.|||.:.|.|..|.||
Human  2004 LFGGVITNNVVSLDCEHVSQTAEEFYTVRCQVADMKNIYESLDEVTIKDTLEGDNMYTCSHCGKK 2068

  Fly  1893 VVTVKRVCVKKLPPVLAIQLKRFEYDYERVCAIKFNDYFEFPRILDMEPYT---VSGLAKLEGEV 1954
            |...||.|.||||.:|:....|:.::...:...|.|.:|.||..|||.|||   :.|.::.:...
Human  2069 VRAEKRACFKKLPRILSFNTMRYTFNMVTMMKEKVNTHFSFPLRLDMTPYTEDFLMGKSERKEGF 2133

  Fly  1955 VEVGDNCQTNVETTKYELTGIVVHSGQASGGHYFSYILS-KNP---ANGKCQWYKFDDGEVTECK 2015
            .||.|:.:.: |:.:|:|.|:.||:|.|.||||:|:|.. .||   .|.|  ||.|:|.||   |
Human  2134 KEVSDHSKDS-ESYEYDLIGVTVHTGTADGGHYYSFIRDIVNPHAYKNNK--WYLFNDAEV---K 2192

  Fly  2016 MHEDEEMKAECFGGEYMGETYDNNLKRMQYRRQKRWWNAYMLFYTRCDQTPVQYEPSVEQLSLAE 2080
            ..:..::.:||||||...:|||:...:......::..:||||||.|       .||..|     .
Human  2193 PFDSAQLASECFGGEMTTKTYDSVTDKFMDFSFEKTHSAYMLFYKR-------MEPEEE-----N 2245

  Fly  2081 SRNMVLPLPKPIERSVRHQNIRFLHSRSIFSVEFFNFIKKLVSCNLLSARSNKITPAAEELSLLG 2145
            .|.....:...:...:.|.|::||..::||...:|.|:.:|.||      .....|..:.:||:.
Human  2246 GREYKFDVSSELLEWIWHDNMQFLQDKNIFEHTYFGFMWQLCSC------IPSTLPDPKAVSLMT 2304

  Fly  2146 VQLASQFLFHTGFRTKKSLRGPVMEWYDALSHHIRSSALVRKWFANHALLSPPSRLG-------E 2203
            .:|::.|:..|...:|:  :..:::|.:.|:....:|....:||.:        |:.       :
Human  2305 AKLSTSFVLETFIHSKE--KPTMLQWIELLTKQFNNSQAACEWFLD--------RMADDDWWPMQ 2359

  Fly  2204 YILMAPSPDVRTVFVKLVV--------FFCHFAINDEPLTGYD---------GANLCEQVLISVL 2251
            .::..|:..||.:|.:|.:        ...|..:......|.|         |...|....:..|
Human  2360 ILIKCPNQIVRQMFQRLCIHVIQRLRPVHAHLYLQPGMEDGSDDMDTSVEDIGGRSCVTRFVRTL 2424

  Fly  2252 RLLKSEAA-DYGKHLPHYFSLFSMYVGLGTREKQQLLRLNVPLQFIQVALDDGPGPAIKYQYPEF 2315
            .|:..... .:.|||..||:....:..:|..|.|.||.|......:...:.. .||    :.|:.
Human  2425 LLIMEHGVKPHSKHLTEYFAFLYEFAKMGEEESQFLLSLQAISTMVHFYMGT-KGP----ENPQV 2484

  Fly  2316 SKLHQVVSHLIRCSDVSEKCQSSNQNARPLSNPFKDPNVAHEELTPLSTECMDLLFNRTGYIKKV 2380
            ..|.:            |:.:...:....||       :|.|:..|.:.|.|..|      :..:
Human  2485 EVLSE------------EEGEEEEEEEDILS-------LAEEKYRPAALEKMIAL------VALL 2524

  Fly  2381 IEDTNVGDEGLKLLQYCSWENPHFSRAVLTELLWQCG-----FAYCH-----DMRHHTDLLLNIL 2435
            :|.:. .:..|.|.|              |::....|     |.:.|     ::|...:|:.::.
Human  2525 VEQSR-SERHLTLSQ--------------TDMAALTGGKGFPFLFQHIRDGINIRQTCNLIFSLC 2574

  Fly  2436 LIDDSWQHHRIHNALNGVAEEREGLLETIQRAKTHYQKRAYQIIKCLTQLFH-------KSPIAL 2493
                     |.:|.|   ||....:|.|.....|  .:.|....|.||.|..       ..|.|.
Human  2575 ---------RYNNRL---AEHIVSMLFTSIAKLT--PEAANPFFKLLTMLMEFAGGPPGMPPFAS 2625

  Fly  2494 QMLHTNSNITRHWSI-------AVEWLQGELDRQRGIGCQYNSYSW 2532
            .:|.      |.|.:       .::||..:..|.:      .::||
Human  2626 YILQ------RIWEVIEYNPSQCLDWLAVQTPRNK------LAHSW 2659

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fafNP_524612.2 peptidase_C19C 1666..2064 CDD:239124 126/408 (31%)
UCH 1668..2059 CDD:278850 123/401 (31%)
USP34NP_055524.3 peptidase_C19C 1892..2241 CDD:239124 127/415 (31%)
UCH 1894..2236 CDD:278850 123/401 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5077
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D625455at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.