DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: faf and UBP15

Sequence 1:NP_524612.2 Gene:faf FlyBaseID:FBgn0005632 Length:2778 Species:Drosophila melanogaster
Sequence 2:NP_014033.1 Gene:UBP15 SGDID:S000004920 Length:1230 Species:Saccharomyces cerevisiae

Alignment Length:1097 Identity:226/1098 (21%)
Similarity:371/1098 (34%) Gaps:349/1098 (32%)


  Fly  1653 WDYLPPVGARPTKGFCGLKNAGATCYMNSVLQQLYMVPAVRVGILRAHGAATTDGEDFSGDSDLT 1717
            |.......::...|:.|.:|.|||||:||:||..:.....|                        
Yeast   190 WHNFLNYDSKKVTGYVGFRNQGATCYLNSLLQSYFFTKYFR------------------------ 230

  Fly  1718 GGGLGSALFSGPASALVSLPSSSSTIEDGLHDVRKNYHVVILKHVQAIFAHLGHSALQYYVPRGL 1782
                         ..:..:|:.        |:...|...:.|   |..|..|..|.:        
Yeast   231 -------------KLVYEIPTE--------HESPNNSVPLAL---QRAFYQLQVSDI-------- 263

  Fly  1783 WTHFKLLGEPVNLRE--------------QQDAVEFFMSLLESLDEGLKALGQPQLMNATLGGSF 1833
                     |::..|              |.|..|....|::.|:..:|.......:|....|..
Yeast   264 ---------PLDTLELTRSFGWDTAESFTQHDVQELNRILMDRLENNMKGTPVEGKLNEIFVGKM 319

  Fly  1834 SDQKICQECPHRYSKEEPFSVFSVDIRNHSSLTESLEQYVKGELLEGADAYHCDKCDKKVVTVKR 1898
            .....|....:..::.|.|....::::|..:|.||.:.|::.||:.|.:.|.......:... |.
Yeast   320 KSYIKCINVDYESARVEDFWDLQLNVKNFKNLQESFDNYIEMELMNGENQYAAQDYGLQDAQ-KG 383

  Fly  1899 VCVKKLPPVLAIQLKRFEYDYERVCAIKFNDYFEFPRILDMEPYTVSGLAK--LEGEVVEVGDNC 1961
            |..:..||||.:||||||||:.....:|.||.:|||..:|:.|:....:.|  |:.|      |.
Yeast   384 VIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLKKTLDSE------NK 442

  Fly  1962 QTNVETTKYELTGIVVHSGQASGGHYFSYILSKNPANGKCQWYKFDDGEVTECKMHEDEEMKAEC 2026
            ..|...  |.|.|::||||..|.|||::.|    ....:.|||:|||..|...   ..:::..|.
Yeast   443 DKNPYV--YNLHGVLVHSGDISTGHYYTLI----KPGVEDQWYRFDDERVWRV---TKKQVFQEN 498

  Fly  2027 FGGEYMGETYDNNLKRMQYRRQ--KRWWNAYMLFYTRCDQTPVQYEPSVEQLSLAESRNMVLPLP 2089
            ||.:.:.:.....:.|.:|:..  :|..:||||.|.|.:|......|.:|.           .:|
Yeast   499 FGCDRLPDEKVRTMTRGEYQNYIIQRHTSAYMLVYIRQEQEEDLLRPVLES-----------DVP 552

  Fly  2090 KPI---------ERSVRHQNIR--------FLHS-RSIFSVEFFNFIKKLVSCNLLSARSNKITP 2136
            |.:         ||..:.:.||        .||| :.....|.|::.           ..:....
Yeast   553 KHVITRVREEIKERETKEKEIREAHLYVTLRLHSIKEFIHYEGFDYF-----------AHDGFRL 606

  Fly  2137 AAEELSLLGVQLASQFLFHTGFRTKKS-LRGPVMEWYDALSHHIRSSALVRKWFANHALLSPPSR 2200
            .||||:..|:|..:..:..|   ||.| :...:.|     :.:|.....|:.|..::.       
Yeast   607 FAEELNDSGLQQINLKVLRT---TKLSDIFASIKE-----TMNIPQERDVKYWKMDYR------- 656

  Fly  2201 LGEYILMAPSPDVRTVFVKLVVFFCHFAINDEPLTGYDGANLCEQVLISVLRLLKSE-----AAD 2260
                         |...::|.          :|:.       .|.|.|::...||.|     ...
Yeast   657 -------------RNSTLRLT----------QPIN-------FESVNITLQEALKKEKKRTMQTQ 691

  Fly  2261 YG-----------KHLPHYFSLFSMYVGLGTREKQQLLRLNVPLQFIQVALDDGPGPAIKYQYPE 2314
            ||           |.|....|...:::.....|.|.|.:|.......:..|||.....|:...||
Yeast   692 YGEEGVASTEEDDKALLETVSFLDLFIEEPYLELQFLNKLKEASLISKAQLDDELISTIRTNLPE 756

  Fly  2315 FSK-------------------------------LHQVVSHLIRCSDVS---EKCQSSNQNARPL 2345
            .:|                               .|..|:.|.:.||:|   |...|||:..   
Yeast   757 LTKGGIEPVFATDNKSNLLFVKSYDPHTQKLLGFGHFAVNQLQQLSDISAIIEDSISSNEKL--- 818

  Fly  2346 SNPFKDPNVAHEELTPLSTECMDLLFNRTGYIKKVIEDTNVGDEGLKLLQYCSWENPHFSRAVLT 2410
                    ..:||:.|.:...:        |:|:.|.|.:: |.|    ...|:|.|   .|||.
Yeast   819 --------TFYEEVQPGTINEI--------YMKETIYDADI-DTG----DIVSFEVP---GAVLP 859

  Fly  2411 ELLWQCGFAYCHD----MRHHTDLLLNILLIDDSWQHHRIHNALNGVAEEREGLLETIQRAKTHY 2471
            :..  ..:|...|    :|:...|..:  ..|.|.:.:       ||:.|.....|....|...|
Yeast   860 DTF--PVYATIKDFYSYLRYRVKLKFS--KFDGSSEEY-------GVSNEIPESFEFWISAYAPY 913

  Fly  2472 QKRAYQIIKCLTQLFHKSPIALQMLHTNSN---ITRHWSIAVEWL-------------------- 2513
            .    .:.:.:::..|..|..|:::...||   :.:..|:..::|                    
Yeast   914 D----DLARMVSKYAHVKPEYLKIIALYSNGRFVLKSTSLLNDYLLKDFNCDQIPPFAFEVLSVP 974

  Fly  2514 QGELDRQRGIGCQY--NSYSWSPPAQ---SNDNTNGYMLERSQ---------------------- 2551
            ..||:|.|.|...:  |||......:   :||.|....||:.|                      
Yeast   975 LKELERLRPIKLYWLKNSYIHYQCFEFEVANDYTESQFLEKVQHKIGFTDEEKENILLWTNTNFQ 1039

  Fly  2552 -----SAKNTW------SMAF-ELCPDEVSEKTDENNEPNLETNM------DENKSE 2590
                 |.:||:      |:.| .:.|:|.....:.|...|::|:.      |||.::
Yeast  1040 FQGLLSDQNTFKDVSKHSLLFGRILPEESKLFKELNRLENVQTSSLEDFMDDENATD 1096

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fafNP_524612.2 peptidase_C19C 1666..2064 CDD:239124 101/416 (24%)
UCH 1668..2059 CDD:278850 98/409 (24%)
UBP15NP_014033.1 COG5077 1..1229 CDD:227409 226/1098 (21%)
MATH_Ubp21p 40..180 CDD:239744
peptidase_C19C 203..538 CDD:239124 101/416 (24%)
USP7_ICP0_bdg 648..931 CDD:289221 66/362 (18%)
USP7_C2 965..1217 CDD:291217 27/133 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5077
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.