DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: faf and usp9

Sequence 1:NP_524612.2 Gene:faf FlyBaseID:FBgn0005632 Length:2778 Species:Drosophila melanogaster
Sequence 2:XP_005167793.1 Gene:usp9 ZFINID:ZDB-GENE-061019-1 Length:2594 Species:Danio rerio

Alignment Length:2698 Identity:1269/2699 (47%)
Similarity:1711/2699 (63%) Gaps:255/2699 (9%)


  Fly    48 TGTVANSSLPGG-GSGSLDGNQDQQPATDSQSSDDVAASLSANSVDSTITIVPP----------- 100
            |.|...|.:.|. |.|.....|.|.|...:|:|       |.||.:....:.||           
Zfish     2 TATTRGSPVGGNDGQGQAPDGQSQPPLPQNQTS-------SPNSSNENSPVSPPDDQGQGDSPTP 59

  Fly   101 -EKLISSFPTTKLRSLTQKISNPRWVVPVLPEQELEVLLNAAIELTQAGVDHDCEPCVEFYRNGL 164
             |:...:||.|:|..|...|:.|||||||||:.||||||.|||:|.:.|:|..||.|..|:|:||
Zfish    60 LEEEEPAFPHTELAKLDDMINRPRWVVPVLPKGELEVLLEAAIDLCKKGIDVKCEACQRFFRDGL 124

  Fly   165 STSFAKILTDEAVNSWKNNIHHCILVSCGKLLHLIAIHMQRDNPYLLDLLAIVFDPENKFNTFNA 229
            :.||.||||||||:.||..||.||:.:..:|:.|....:.:|...||:|||:..:|..||:.:|.
Zfish   125 TISFTKILTDEAVSGWKFEIHRCIINNAHRLVELCVTKLSQDWFPLLELLAMATNPHCKFHIYNG 189

  Fly   230 GRQPECFAAPDYIWG-QLDSNKMYARPPPEPKNARGWLVDLINRFGQLGGFDNLLERFNIGLELL 293
            .|..|...|     | ||..::::|| ||:|::.:||||||||:||.|.||..|.:||..|    
Zfish   190 TRPSETVPA-----GVQLAEDELFAR-PPDPRSPKGWLVDLINKFGTLNGFQTLHDRFMSG---- 244

  Fly   294 KRNQNKCTGKNISVEGRVENGAQDNRLTLALIHSLLRPFGQCYELLMPATIAKYFMPTWNVVLDL 358
                                    ..|.:.:|.:|::|||||||.|...|:.|||:|...:|...
Zfish   245 ------------------------QALNVQIIAALIKPFGQCYEFLTLHTVKKYFLPIIEMVPQF 285

  Fly   359 LDSFTDEELKREVKPEGRNDYINGIVKSARLLASRLTGQEELIRDLEMFRLKMILRLLQVSSFNG 423
            |::.||||||:|.|.|.:||.::.|:||.:.||||:.||||.:::||:|||||||||||:|||||
Zfish   286 LENLTDEELKKEAKNEAKNDALSMIIKSLKNLASRVPGQEETVKNLEIFRLKMILRLLQISSFNG 350

  Fly   424 KMNALNEINKVLSSVAYFSHRSQPLPHCMPEDEMDWLTADRMAQWIKSSDVLGVVLKDSLHQPQY 488
            |||||||:|||:|||:|::||     |..||:| :||||:|||:||:.:::|.:||:||||||||
Zfish   351 KMNALNEVNKVISSVSYYTHR-----HGNPEEE-EWLTAERMAEWIQQNNILSIVLRDSLHQPQY 409

  Fly   489 VEKLEKIIRFLIKEQALTLDDLDAVWRAQAGKHEAIVKNVHDLLAKLAWDFTPEQLDHLFEAFQA 553
            |||||||:||:|||:||||.|||.:|.||||||||||||||||||||||||:||||||||:.|:.
Zfish   410 VEKLEKILRFVIKEKALTLQDLDNIWAAQAGKHEAIVKNVHDLLAKLAWDFSPEQLDHLFDCFKE 474

  Fly   554 SMTTANKRQRERLLELIRRLAEDDKNGVMAQKVLKLFWTLAHSQEVPPEVLDQALGAHVKILDYS 618
            |.|.|:|:|||:|||||||||||||:||||.|||.|.|.||||.:||.:::||||.||:||||||
Zfish   475 SWTNASKKQREKLLELIRRLAEDDKDGVMAHKVLNLLWNLAHSDDVPVDIMDQALSAHIKILDYS 539

  Fly   619 CSQERDAQKTIWLDKCVDELKSGDGWVLPALRLIRDICCLYDTTTNHAQRTQTSTN---RQQVIE 680
            |||:||.||..|:|:.::||::.|.||:|||:.||:||.|:.....:..:||.|.:   |..:|.
Zfish   540 CSQDRDTQKMQWIDRFIEELRTNDKWVIPALKQIREICSLFGEAPQNLSQTQRSPHVFYRHDLIN 604

  Fly   681 RLQNDYSLVILVTNSLTAYMEKVRQMVTDSPGLDATRILIDGRFPHHVQIAERLEFLKFLLKDGQ 745
            :||::::||.||..:|:||||.:||...:....|...:....|:.|..::.|||.||:|||||||
Zfish   605 QLQHNHALVTLVAENLSAYMENMRQFSKEHADFDPQTVRPGSRYSHVQEVQERLNFLRFLLKDGQ 669

  Fly   746 LWLCADQAKQIWHCLAVNAVFPADREECFRWFGKLMGEEPDLDPGINKDFFENNILQLDPHLLTE 810
            |||||.||||||.|||.||||..|||.||:|:.||||:||||||.|||||||||:|||||.||||
Zfish   670 LWLCAPQAKQIWKCLAENAVFLCDREACFKWYSKLMGDEPDLDPDINKDFFENNVLQLDPSLLTE 734

  Fly   811 SGIKCFERFFKAVNSKEDKLKAIHRGYMLDNEDLIGKDYLWRVITTGGEEIASKAIDLLKEVSTA 875
            :|:|||||||||||.:|.||.|..|.||:|:.:|||.||||||:..|.::|||:|||||||:.|.
Zfish   735 NGMKCFERFFKAVNCREGKLVAKRRAYMMDDLELIGLDYLWRVVIQGSDDIASRAIDLLKEIYTN 799

  Fly   876 LGPRLQENIAEFHEMFIGECCSRLRTHYGNIVILGKTQLQEELDAPDQSDNTNDESKDS-KMRFI 939
            |||:||.|..|.||.||..|..||:..|..:.:|                   |..||| .....
Zfish   800 LGPKLQANQVEIHEDFIQSCFDRLKASYDTLCVL-------------------DGDKDSINCARQ 845

  Fly   940 EAEKMCRILKVLQEYVKECDRSFSGDRVHLPLSRVTRGKNTILYIRFQNPGRSIDDMEIVTHSNE 1004
            ||.:|.|:|.||:||:.|||..:..:|..||:||..|||:..|.:||.|.||.:||::|.:|:|:
Zfish   846 EAIRMVRVLTVLREYITECDSDYHEERTILPMSRAFRGKHITLVVRFPNQGRQVDDLDIWSHTND 910

  Fly  1005 TMAAFKRNLLKRIKGTSTANIKVDLFYANDEMIGVSDEINPLYQYTIRDKMNLTAKLTPVGTGLA 1069
            |:.:.:|.:|.|||..|| :.|::||... |:|..:|:...:.|..::||..:|||||.|...:.
Zfish   911 TIGSVRRCILNRIKANST-HTKIELFIGG-EIIDPADDRKLIGQLNLKDKTLITAKLTQVSANMP 973

  Fly  1070 SSPDSSSDSSTGSP----------PRPCPDMQRVESESTLPGVIISQNYQYTEFFLKLYQLGSDL 1124
            ||||||||||||||          |.|       |.||.|||||:|.:.:|..|..::..||.:|
Zfish   974 SSPDSSSDSSTGSPGNHGNHYSDGPNP-------EVESCLPGVIMSLHVRYISFLWQVADLGCNL 1031

  Fly  1125 EHGRLRDSAKVLLHLLPCDRQTIRQLKIMCKVPKAAVTVAVTGDKIAKDEEEKLYPTEQAGIEDE 1189
            ....|||.|:||:.|:|.|..|:..|:.:|.             ..||..|..|.|         
Zfish  1032 NMPLLRDGARVLMKLMPPDNATVENLRAICL-------------DHAKLGENSLSP--------- 1074

  Fly  1190 EEHCTPEQMFLHPTPAQVLYNLSVLHGLLIPALDPLGESALLVQSAWMHSGCAHFVLELLTKNNF 1254
                |.:..|..|:|:||||.:.|::.||:||...|||.|...|..::.||....||.:||:|||
Zfish  1075 ----TLDSRFFGPSPSQVLYLIEVVYALLMPASGTLGEDASDFQYNFLKSGGLPLVLSMLTRNNF 1135

  Fly  1255 LPSADMHTKRASFQCVLRLAKLFLYIVG-SVLSRVGD--EPM------ICDLDNGSRSQVDILKQ 1310
            ||:|||.|:|.::...|::|||.|..|| ..:..|.:  :|:      :..::..:..|..:|:.
Zfish  1136 LPNADMETRRGAYLNALKIAKLLLTAVGFGHVKSVAEACQPVVEGTIPVSPINQTTHDQALVLQN 1200

  Fly  1311 NFSTMPS-SSQGTLRAISAKLAVILAREMLSASPEGDRCRTLFSSTLQWSCPDISTIKAVVQLAW 1374
            ....:|: |::..||.::.:||..::.|            ..|.::..  .|||..|:||.::.|
Zfish  1201 ALQNIPNPSAECMLRNVAIRLAQQISDE------------NFFQASKY--IPDICVIRAVQKIVW 1251

  Fly  1375 ASSCGNLQALGNSSGDFE---------DEVIVPDGQDFSMCKEALEVLTISFILNPSANEALTSD 1430
            ||.||::|.:.:|:.:..         :|   ||.:|..:|.|||||:|:.|.|.|:|.:||:.:
Zfish  1252 ASGCGSVQHVFSSNEEISKIYEKTNAGNE---PDAEDEQVCCEALEVMTLCFALMPTALDALSKE 1313

  Fly  1431 PNWPKFITSIVLKNPLRHVRQVASEQLFLASTYCAGDRRPFVYMVNLLVGALKTLVPQYESTCAE 1495
            ..|..||..::|....:.|||:|.||.||.:|.|....||.::.:.||...|.:...:.....|:
Zfish  1314 KAWQTFIIDLLLHCQSKSVRQMAQEQFFLMATRCCMGHRPLLFFITLLFTVLGSTAKERAKHAAD 1378

  Fly  1496 FFSVLCRTLSYGCIYNWPLQISEGLLGDEIKWLQRIRENVHATGDTQVHEELLEGHLCLAKELMF 1560
            :|::|...|:|....|..|..:|.||.:||.||:|||:.|..||:..|.|.:||||:.:.|||:.
Zfish  1379 YFTLLRHLLNYAFNSNINLPNAEVLLNNEIDWLKRIRDEVKRTGEPGVEETILEGHIGVTKELLA 1443

  Fly  1561 FLGADSKAQLN------ELIHELIDDFLFTASREFLHLRRHGSLRQDTVPPPVCRSPHTIAAACD 1619
            |...:.|..:.      .||.||:|||||.||..:|...:.|....:.. .|||.:|.||.|..:
Zfish  1444 FQTPEKKFYIGCEKGGASLIKELMDDFLFPASNVYLQYMKSGEFPTEQA-IPVCSTPATINAGFE 1507

  Fly  1620 LLIALCQLCVPNMKLLTNTLIDFVCTDTDPLREWDYLPPVGARPTKGFCGLKNAGATCYMNSVLQ 1684
            ||:||...||.|:|.:.:||.|......:||.||:||||||.||||||.||||||||||||||:|
Zfish  1508 LLVALAIGCVRNLKQIVDTLTDMYYLGCEPLTEWEYLPPVGPRPTKGFVGLKNAGATCYMNSVIQ 1572

  Fly  1685 QLYMVPAVRVGILRAHGAATTDGEDFSGD---SDLTGGGLGSALFSGPASALVSLPSSSSTIEDG 1746
            ||||:|.:|.|||...|..:...:|.|||   .:.:.......:| |........||.|.: || 
Zfish  1573 QLYMIPPIRNGILAIEGTGSDVDDDMSGDEKQDNESNVDPRDEVF-GYQHQFDDKPSLSKS-ED- 1634

  Fly  1747 LHDVRKNYHVVILKHVQAIFAHLGHSALQYYVPRGLWTHFKLLGEPVNLREQQDAVEFFMSLLES 1811
                ||.|::.:|:.:|.||.||..|.||||||||.|..|:|.|||||||||.||:|||.||::|
Zfish  1635 ----RKEYNIGVLRQLQVIFGHLASSRLQYYVPRGFWKQFRLWGEPVNLREQHDALEFFNSLVDS 1695

  Fly  1812 LDEGLKALGQPQLMNATLGGSFSDQKICQECPHRYSKEEPFSVFSVDIRNHSSLTESLEQYVKGE 1876
            |||.|||||.|.:::..|||||:||||||.|||||..||.|:..:||||||.:|.:|:||||||:
Zfish  1696 LDEALKALGHPAMLSKVLGGSFADQKICQGCPHRYECEESFTTLNVDIRNHQNLLDSMEQYVKGD 1760

  Fly  1877 LLEGADAYHCDKCDKKVVTVKRVCVKKLPPVLAIQLKRFEYDYERVCAIKFNDYFEFPRILDMEP 1941
            |||||:||||:||:|||.||||:.:||||||||||||||:||:||.|||||||||||||.|||||
Zfish  1761 LLEGANAYHCEKCNKKVDTVKRLLIKKLPPVLAIQLKRFDYDWERECAIKFNDYFEFPRELDMEP 1825

  Fly  1942 YTVSGLAKLEGEVVEVGDNCQTNVE-----------TTKYELTGIVVHSGQASGGHYFSYILSKN 1995
            |||:|:|||||..|. .:|.|..::           :::|.|.|::|||||||||||:|||:.:|
Zfish  1826 YTVAGVAKLEGSDVH-PENQQQVIQQNEPSEPEPPCSSRYRLVGVLVHSGQASGGHYYSYIIQRN 1889

  Fly  1996 PANG---KCQWYKFDDGEVTECKMHEDEEMKAECFGGEYMGETYDNNLKRMQYRRQKRWWNAYML 2057
            .:.|   :.:|||||||:||||||.:|||||.:|||||||||.:|:.:|||.|||||||||||:|
Zfish  1890 GSGGEGERNRWYKFDDGDVTECKMDDDEEMKNQCFGGEYMGEVFDHMMKRMSYRRQKRWWNAYIL 1954

  Fly  2058 FYTRCDQTP-----VQYEPSVEQLSLAESRNMVLPLPKPIERSVRHQNIRFLHSRSIFSVEFFNF 2117
            ||.|.|...     |:|   :.:|:::...:.| .:|..||||||.||::|:|:|..:|:|:|.|
Zfish  1955 FYERMDTLDKDSELVKY---ITELTVSSKPHQV-KMPSAIERSVRKQNVQFMHNRMQYSLEYFQF 2015

  Fly  2118 IKKLVSCNLLSARS----NKITPAAEELSLLGVQLASQFLFHTGFRTKKSLRGPVMEWYDALSHH 2178
            |:||::||.:...|    :.:.|.|||::::.:|||::|||.|||.|||.:|||..:|||||...
Zfish  2016 IRKLLTCNSVYLNSPPGQDHLLPEAEEMAMISIQLAARFLFSTGFHTKKIVRGPASDWYDALCIL 2080

  Fly  2179 IRSSALVRKWFANHALLSPPSRLGEYILMAPSPDVRTVFVKLVVFFCHFAINDEPL--------- 2234
            :|.|..||.|||::.|.:.|:|..||:|..||.:||..|.||:||..||::.|.|.         
Zfish  2081 LRHSKNVRYWFAHNVLFAYPNRFSEYLLECPSAEVRGAFSKLIVFIAHFSLQDGPCPTPIASPGP 2145

  Fly  2235 --TGYDGANLCEQVLISVLRLLKSEAADYGKHLPHYFSLFSMYVGLGTREKQQLLRLNVPLQFIQ 2297
              .|.|..:|.|.:..:||.||:.|.:::|:||..||:||.||..||..||.|||:|.||..|:.
Zfish  2146 SSQGCDNLSLSEHLFRAVLNLLRREVSEHGRHLQQYFNLFVMYANLGLAEKTQLLKLGVPATFML 2210

  Fly  2298 VALDDGPGPAIKYQYPEFSKLHQVVSHLIRCSDVSEKCQSSNQNARPLSNPFKDPNVAHEELTPL 2362
            ||||:||||.|||||.|..||:.|||.|:||.||:.:.|||.....||:||:.|||.. ..:.||
Zfish  2211 VALDEGPGPPIKYQYAELGKLYTVVSQLVRCCDVTSRMQSSINGNPPLANPYGDPNTT-TPIMPL 2274

  Fly  2363 STECMDLLFNRTGYIKKVIEDTNVGDEGLKLLQYCSWENPHFSRAVLTELLWQCGFAYCHDMRHH 2427
            ....:|:||.||.|:||:|||.:..::.:|||::|.||||.||..||:|||||..::|.:::|.:
Zfish  2275 QQLVVDILFVRTSYVKKIIEDCSNSEDTIKLLRFCCWENPQFSSTVLSELLWQVAYSYTYELRPY 2339

  Fly  2428 TDLLLNILLIDDSWQHHRIHNALNGVAEEREGLLETIQRAKTHYQKRAYQIIKCLTQLFHKSPIA 2492
            .||||.||.|:||||.|||||.|.|:.::|:||.:||||:|.||||||||.|||:..||....:|
Zfish  2340 LDLLLQILFIEDSWQTHRIHNVLKGIPDDRDGLFDTIQRSKNHYQKRAYQCIKCMVALFSNCSVA 2404

  Fly  2493 LQMLHTNSNITRHWSIAVEWLQGELDRQRGIG-CQYNSYSWSPPAQSNDNTNGYMLERSQSAKNT 2556
            .|:|.:|.::.|.|:.|||||..||:|:...| .||...:||||.|||:.:|||.||||.||:.|
Zfish  2405 YQILQSNGDLKRKWTWAVEWLGDELERRPYTGNTQYTYNNWSPPVQSNETSNGYFLERSHSARMT 2469

  Fly  2557 WSMAFELCPDE--------VSEK-------------------TDENNEPNLETNMDENKSEPVAQ 2594
            .:.|.||||:|        |||:                   ..::.||:.:..:||  .:|...
Zfish  2470 LAKACELCPEECHLTKHEVVSEEDAGRNPSSTQQLLPGEVTGPQQHTEPDEQEALDE--QDPSPP 2532

  Fly  2595 PGGVLEGSTGGTEQLPENKTPTTSSPSTAAWPA 2627
            ....|...:.|::...:|..|.| .|.|.  ||
Zfish  2533 EDTALYPHSPGSKFQQQNNLPHT-QPYTG--PA 2562

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fafNP_524612.2 peptidase_C19C 1666..2064 CDD:239124 250/415 (60%)
UCH 1668..2059 CDD:278850 245/408 (60%)
usp9XP_005167793.1 peptidase_C19C 1554..1961 CDD:239124 250/415 (60%)
UCH 1556..1956 CDD:278850 245/408 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5077
Hieranoid 1 1.000
Homologene 1 1.000 H3418
Inparanoid 1 1.050 2267 1.000 Inparanoid score I36
OMA 1 1.010
OrthoDB 1 1.010 D22076at33208
OrthoFinder 1 1.000 FOG0001696
OrthoInspector 1 1.000 T1052128
orthoMCL 1 0.900 OOG5_130114
Panther 1 1.100 LDO PTHR24006
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4564
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.