DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: faf and Usp47

Sequence 1:NP_524612.2 Gene:faf FlyBaseID:FBgn0005632 Length:2778 Species:Drosophila melanogaster
Sequence 2:NP_523937.2 Gene:Usp47 FlyBaseID:FBgn0016756 Length:1556 Species:Drosophila melanogaster

Alignment Length:1138 Identity:238/1139 (21%)
Similarity:382/1139 (34%) Gaps:357/1139 (31%)


  Fly  1648 DPLREWDYLPPVGA------------------RPTKGFCGLKNAGATCYMNSVLQQLYMVPAVRV 1694
            |.||.|..:...||                  ...:|:.||.|...|||:||:||.|:|.|..|.
  Fly   358 DELRAWQRVNTTGADFVSSATTETEAEARQASLGPRGYVGLVNQAMTCYLNSLLQALFMTPEFRN 422

  Fly  1695 GILRAHGAATTDGEDFSGDSDLTGGGLGSALFSGPASALVSLPSSSSTIEDGLHDVRKNYHVVIL 1759
            .:.|         .:|..|::                                   .||    |.
  Fly   423 ALYR---------WEFDNDNE-----------------------------------AKN----IP 439

  Fly  1760 KHVQAIFAHLGHSALQYYVPRGLWTHFKLLGEPVNLREQQDAVEFFMSLLESLDEGLKALGQPQL 1824
            ..:|.:|.:|..|.........|...|.  .:.....:|.|..|....:.::|:...|...|..|
  Fly   440 YQLQKLFLNLQTSPKAAVETTDLTRSFG--WDSTEAWQQHDIQELCRVMFDALEHKFKNTKQANL 502

  Fly  1825 MNATLGGSFSDQKICQECPHRYSKEEPFSVFSVDIR------NHSSLTESLEQYVKGELLEGADA 1883
            ::....|..:|...|.||....::|:.|....:.:|      .:.|:.|:|..:|:.|.|:|.:.
  Fly   503 ISNLYEGKMNDYVKCLECNTEKTREDTFLDIPLPVRPFGSSSAYGSIEEALRAFVQPETLDGNNQ 567

  Fly  1884 YHCDKCDKKVVTVKRVCVKKLPPVLAIQLKRFEYDYERVCAIKFNDYFEFPRILDMEPY------ 1942
            |.|:||.||....|.:..|..|.:|.:.||||::||:.:..||.||...||:.|::..:      
  Fly   568 YLCEKCKKKCDAHKGLHFKSFPYILTLHLKRFDFDYQTMHRIKLNDRVTFPQTLNLNTFINRSGN 632

  Fly  1943 ----------TVSGLAKLEGEVVEVGDNCQTNVETTK---------------------------- 1969
                      ||...:..:.......||..:.|.||.                            
  Fly   633 SGEQNSQLNGTVDDCSTADSGSAMEDDNLSSGVVTTASSSQHENDLNDEDEGIDMSSSTSKSAKQ 697

  Fly  1970 ------YELTGIVVHSGQASGGHYFSYILSKNPANGKCQWYKFDDGEVTECKMHEDEEMKAECFG 2028
                  |||..|::|||.||||||::||  |:..|.  :|:.|:|..||.....:.:    ..||
  Fly   698 GSGPYLYELFAIMIHSGSASGGHYYAYI--KDFDNN--EWFCFNDQNVTSITQEDIQ----RSFG 754

  Fly  2029 ---GEYMGETYDNNLKRMQYRRQKRWWNAYMLFYTRCDQTPVQYEPSVEQLSLAESRNMVLPLPK 2090
               |.|....|.::.            |||||.|.:.|....:....|...    ..::...|||
  Fly   755 GPNGSYYSSAYTSST------------NAYMLMYRQVDAKRNELVAKVADF----PEHIKTLLPK 803

  Fly  2091 -------PIERSVRHQNIRFLHSRSIFS--VEFFN-FIKKLVSCNLLSARS---NKITPAAEELS 2142
                   .:.|..||..:..|....::.  |.|:| .:||:....:..::|   |.:..:|.|  
  Fly   804 LHSEEETRVSRLGRHITVTDLALPDLYKPRVYFYNPSLKKMKITRVYVSQSFNINLVLMSAYE-- 866

  Fly  2143 LLGVQ----------LASQFLFHTGFRTKKSLRGPVMEWYDALSHHIRSSALVRKWFANHALLSP 2197
            :|.|:          :|......|..::.:|...|.:....|..::.....|..:.......:.|
  Fly   867 MLNVEQFAPLSRCRLVAYNSSMDTIIQSLESCTDPALTELRAAQNYSLDFLLEYRAEDQEFEVYP 931

  Fly  2198 PSRLGEYILMAPSPDVRTVFVKLVVFFCHFAINDEPLTGYDGANLCEQVLISVLRLLKSEAADYG 2262
            |:.:..|:...   |:.|:.:            |.|...|..|.             :.||:|..
  Fly   932 PNGITWYVFKV---DLSTMAM------------DGPFLVYSAAR-------------EREASDVL 968

  Fly  2263 KHLPHYFSLFSMYVGLGTREKQQLL---RLNVPLQFIQVALDDGPGP---------------AIK 2309
            :.        |:.:.|...|:|.||   |..||..|  |:.|..|.|               :|.
  Fly   969 RR--------SIALRLHISEQQFLLATVRATVPKAF--VSYDPHPTPEALQHLQNMANTQFKSIT 1023

  Fly  2310 YQYPEFSKLHQVVSHLIRCSDV-SEKCQS------------------SNQN-------ARPLSNP 2348
            |.|............::....| |.:|.|                  |:.|       .|.|..|
  Fly  1024 YFYLNVPNTDAATLEMLGVPTVESVECASGGDVVDAAMMNGVAPGHMSSSNDYDWRRYKRDLVEP 1088

  Fly  2349 FKDPNVAH-----EELTPLSTECMDLLFNRTGYIKKVIEDTNVGDEGLKLLQYCSW-ENPHFS-- 2405
            ...|:.:|     .|.:.||..      :||     ::|..|:...|....|..|. .:|..|  
  Fly  1089 MSQPSPSHGHESNSEDSSLSDG------DRT-----LVETDNMAHRGGGDSQVSSTSHSPQLSSP 1142

  Fly  2406 --RAVLTELLWQCGFAYCHDMRHHTDL-LLNILLIDDSWQHH----RIH-------NALNGVAEE 2456
              .|...:.:.:. .|||:....:... :::.||:..|..|.    ::.       .:.:|...:
  Fly  1143 EDEAASHDAMMRV-HAYCNGNGSYAAADVVDPLLLPTSTNHFFYATKVECVDVVGTGSSSGHQSD 1206

  Fly  2457 REGLLETIQRA-----KTHYQKRAYQIIKCLTQLFHKSPIA---LQMLHTNSNITRHWSIAVEWL 2513
            .|..|....||     .||.:..|::  |.:.||. :.|.|   ||..|.|:             
  Fly  1207 EEAQLRKPTRAYKLLVGTHMRMGAFK--KHIEQLI-QVPAAHFKLQRKHDNN------------- 1255

  Fly  2514 QGELDRQRGIGCQYNSYSWSPPAQSNDNTNGYMLERSQSAKNTWSMAFELCPDEVSEK------T 2572
                                    .::|.|..::...:....|..:...|.|||...|      .
  Fly  1256 ------------------------LSNNQNNSLVHLIEGETLTVELGKTLEPDEFKAKIHFLRLA 1296

  Fly  2573 DENNEP-----------NLETNMDENKSEPVAQ 2594
            |.:||.           |..|..::.|.|.||:
  Fly  1297 DIDNETSKLPCVCEWVYNANTTAEQAKKELVAK 1329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fafNP_524612.2 peptidase_C19C 1666..2064 CDD:239124 113/457 (25%)
UCH 1668..2059 CDD:278850 110/450 (24%)
Usp47NP_523937.2 TEBP_beta <119..234 CDD:254188
Rib_recp_KP_reg 122..265 CDD:282899
peptidase_C19C 394..780 CDD:239124 112/456 (25%)
UCH 395..776 CDD:278850 110/451 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C127930054
eggNOG 1 0.900 E1_COG5077
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24006
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.