DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: faf and Usp24

Sequence 1:NP_524612.2 Gene:faf FlyBaseID:FBgn0005632 Length:2778 Species:Drosophila melanogaster
Sequence 2:XP_006503239.1 Gene:Usp24 MGIID:1919936 Length:2637 Species:Mus musculus

Alignment Length:2839 Identity:799/2840 (28%)
Similarity:1285/2840 (45%) Gaps:543/2840 (19%)


  Fly    34 PAQSAGSGSGIGTG----TGTVANSSLPGGGSGSLDGNQDQQPA----TDSQSSDDVAASLSANS 90
            |..|.|...|.|.|    :|:..:....||.:|. .|..|..||    .|::.:|: ..:.|...
Mouse    55 PMDSGGPSPGPGGGPRGDSGSDGSGPSRGGSTGG-GGGFDPPPAYHEVVDAEKNDE-NGNCSGEG 117

  Fly    91 VDSTITIVPPEKLISSFPTTKLRSLTQKISNPRWVVPVLPEQELEVLLNAAIELTQAGVDHDCEP 155
            ::              ||||.|..|..::....|.:|...|:.|...|.|:..|.:.|:....|.
Mouse   118 IE--------------FPTTNLYELESRVLTDHWSIPYKREESLGKCLLASTYLARLGLSESDEN 168

  Fly   156 CVEFYRNGLSTSFAKILTDEAVNSWKNNIHHCILVSCGKLLHLIAIHMQRDNPY---LLDLLAIV 217
            |..|....:..:|.|:||..||:.|...||..|......|:.|:|..|::| |.   ||.:|.:.
Mouse   169 CKRFMERCMPEAFKKLLTSSAVHKWGTEIHEGIYNMLMLLIELVAERMKQD-PIPIGLLGVLTMA 232

  Fly   218 FDPENKFNTFNAGRQPECFAAPDYIWGQL-DSNKMYARPPPE--PKNARGWLVDLINRFGQLGGF 279
            |:|:|:::..|.      .......|.:: ....|:|..|..  .|...||:|||:|:||:||||
Mouse   233 FNPDNEYHFKNR------MKVSQRNWAEVFGEGNMFAISPVSTFQKEPHGWVVDLVNKFGELGGF 291

  Fly   280 DNLLERFNIGLELLKRNQNKCTGKNISVEGRVENGAQDNRLTLALIHSLLRPFGQCYELLMPATI 344
            ..:              |.|...::|.               |..:.:|::|.|.|.|.|..:.:
Mouse   292 AAI--------------QAKLHSEDIE---------------LGAVSALVQPLGVCAEYLNSSVV 327

  Fly   345 AKYFMPTWNVVLDLLDSFTDEELKREVKPEGRNDYINGIVKSARLLASRLTGQEELIRDLEMFRL 409
            .....|.....:..:.|..:::||     :.|...|..::.:.:||..|.  |..|:..::..||
Mouse   328 QPMLDPVILTTIQDVRSVEEKDLK-----DKRLVSIPELLSAIKLLCMRF--QPALVTTVDALRL 385

  Fly   410 KMILRLLQVSSFNGKMNALNEINKVLSSVAYFSHRSQPLPHCMPEDEMDWLTADRMAQWIKSSDV 474
            .::||:|:...|:.|||:|.|:.|::..    |..|:.:.:.        :..||:..|:..:.|
Mouse   386 DILLRMLKSPHFSAKMNSLKEVTKLIED----STLSKSVKNA--------IDTDRLLDWLVENSV 438

  Fly   475 LGVVLKDSLHQPQYVEKLEKIIRFLIKEQALTLDDLDAVWRAQAGKHEAIVKNVHDLLAKLAWDF 539
            |.:.|:.::.|.||.::::.||..|  ...|:||:|..:|:.|:|:...:::|:|.::|..|..|
Mouse   439 LSIALEGNIDQAQYCDRIKGIIELL--GSKLSLDELTKIWKIQSGQSSTVIENIHTIIAAAAVKF 501

  Fly   540 TPEQLDHLFEAFQASMTTANKRQRERLLELIRRLAEDDKNGVMAQKVLKLFWTLAHSQEVPPEVL 604
            ..:||:|||...|.|..|.:.|.|::||.||.|:..:.:....:.|||.:.|.|||...:|..::
Mouse   502 NADQLNHLFVLIQKSWETESDRVRQKLLSLIGRIGREARFEATSGKVLDVLWELAHLPTLPSSLI 566

  Fly   605 DQALGAHVKILD--YSCSQERDAQKTIWLDKCVDELK---------------------SGD---- 642
            .|||..|:.||.  |:.   ::|.|..::.||::::|                     :||    
Mouse   567 QQALEEHLTILSDAYAV---KEAVKRSYIIKCIEDIKRPGEWSSLEKNKKDGFKQGGLTGDYVSL 628

  Fly   643 ------------------GWVLPALRLIRDICCLYDTTTNHAQRTQTSTNRQQVIERLQNDYSLV 689
                              .||:||||.:.:|      |.:..::|....:: .:|:.|:.::.:|
Mouse   629 PGYTETKRRSSQLNNPQFVWVVPALRQLHEI------TRSFIKQTYQKQDK-SIIQDLKKNFEIV 686

  Fly   690 ILVTNSLTAYMEKVRQMVTDSPGLDATRILIDGRFPHHVQIAERLEFLKFLLKDGQLWLCADQAK 754
            .|||.||.| ..::...|....||... .|:|||:.:...:...|:||.|.|::..|:|..::||
Mouse   687 KLVTGSLLA-CHRLAAAVAGPGGLTGL-TLVDGRYTYREYLEAHLKFLAFFLQEATLYLGWNRAK 749

  Fly   755 QIWHCLAVNA-VFPADREECFRWFGKLMGEEPDLDPGINKDFFENNILQLDPHLLTESGIKCFER 818
            :||.||.... |...|||.||.||.|  |:. ||:..:.:..|:..||:|:.:.:|.:|...|:.
Mouse   750 EIWECLVTGQDVCELDREMCFEWFTK--GQH-DLESDVQQQLFKEKILKLESYEITMNGFNLFKT 811

  Fly   819 FFKAVNSKEDKLKAIHRGYMLDNEDLIGKDYLWRV-ITTGGEEIASKAIDLLKEVS-TALGPRLQ 881
            ||:.||..:.:||.......::..:|:|.|::|:: :.:..||||::||.|:...| ..|.|||:
Mouse   812 FFENVNLCDHRLKRQGAQLYVEKLELVGMDFIWKIAMESPDEEIANEAIQLIINYSYINLNPRLK 876

  Fly   882 ENIAEFHEMFIGECCSRLR-----------THYGNIVILGKTQLQEELDAPDQSDNTNDESKDSK 935
            ::....|:.||.:|.:||.           ||    .:...|::......|..:.:.....:.:|
Mouse   877 KDSVSLHKKFIADCYTRLEAASSALGGPTLTH----AVTRATKMLTATAMPTVATSVQSPYRSTK 937

  Fly   936 MRFIEAEKMCRILKVLQEYVKECDRSFSGDRVHLPLSRVTRGKNTILYIRFQNPGRSIDDMEIVT 1000
            :..||     |:|.:.:.||...:..:|..|..||......|....|.:.:::   :.|...:..
Mouse   938 LVIIE-----RLLLLAERYVITIEDFYSVPRTILPHGASFHGHLLTLNVTYES---TKDTFTVEA 994

  Fly  1001 HSNETMAAFKRNLLKRIKGTSTANIKVDLFYANDEMIGVSDEINPLYQYTIRDKMNLTAKLTPVG 1065
            |||||:.:.:..:.|:: .:...||::   :.||.::.|:.:...|:|....|:..||.|.:..|
Mouse   995 HSNETIGSVRWKIAKQL-CSPVDNIQI---FTNDSLLTVNKDQKLLHQLGFSDEQVLTVKTSGSG 1055

  Fly  1066 TGLASSPDSSSDSSTGSPPRPCPDMQRVESESTLPGVIISQNYQYTEFFLKLYQLGSDLEHGRLR 1130
            |...||.|||:.||:.| .........:|.|.:||||:::   .....|..|||| ::||..|:.
Mouse  1056 TPSGSSADSSTSSSSSS-SGAFSSSYAMEQEKSLPGVVMA---LVCNVFDMLYQL-ANLEEPRIT 1115

  Fly  1131 DSAKVLLHLLPCD---RQTIRQLKIMCKVPKAAVTVAVTGDKIAKDEEEKLYPTEQAGIEDEEEH 1192
            ...:.||.|:|.|   ::.:.||..:             |.|.....|.....::...:..:::|
Mouse  1116 LRVRKLLLLIPTDPAIQEALDQLDSL-------------GRKKTLLSETSSQSSKSPSLSSKQQH 1167

  Fly  1193 CTP------EQMFLHPTPA----QVLYNLSVLHGLLIP-ALDPLGES-ALLVQSAWMHSGCAHFV 1245
             .|      |.:|....|.    :|||||.||...|:| |.|.:..| |......::.:|....|
Mouse  1168 -QPSASSILESLFRSFAPGMSTFRVLYNLEVLSSKLMPTADDDMARSCAKSFCENFLKAGGLSLV 1231

  Fly  1246 LELLTKNNFLPSADMHTKRASFQCVLRLAKLFLYIVGSVLSRVGDEPMICD---------LDNGS 1301
            :.::.:::.....|..|::..:...|:||:..|  ||..:....||.:..|         ..|.|
Mouse  1232 VNVMQRDSIPSEVDYETRQGVYSICLQLARFLL--VGQTMPTSLDEDLTKDGIEALSSRPFRNVS 1294

  Fly  1302 RS---QVDIL----KQNFSTMPSSSQGTLRAISAKLAVILAREMLSASPEGDRCRTLFSSTLQWS 1359
            |.   |:.:.    |.::..:..|.:.::|......|..:|.:.:.||.        |:      
Mouse  1295 RQTSRQMSLCGTPEKSSYRQLSVSDRSSIRVEEIIPAARVAIQTMEASD--------FT------ 1345

  Fly  1360 CPDISTIKAVVQLAWASSCGNLQALGNSSGDFEDEVIVPDG------------------------ 1400
                :|:...::|:||::.|.|..:|:|....|...:.|.|                        
Mouse  1346 ----ATVACFMRLSWAAAAGRLDLVGSSQPIKESNSLFPAGIRSRLSSSGSNCSSSSEGEPAALH 1406

  Fly  1401 ------------QDFSMCKEALEVLTISFILNPSANEALTSDPNWPKFITSIVLKNPLRHVRQVA 1453
                        :|..:..|||.:|.....|......:..|.|....||..|:|.:|...:|:||
Mouse  1407 AGICVRQQSVSTKDALIAGEALSLLVTCLQLRSQQLASFYSLPCVADFIIDILLGSPSAEIRRVA 1471

  Fly  1454 SEQLF-LASTYCAGDRRPFVYMVN-LLVGALKTL-VPQYEST-------------CAEFFSVLCR 1502
            .:||: |:.|..:.  .|.|...| .|:|.:.|. :|.:..|             |.|:|.:.|:
Mouse  1472 CDQLYTLSQTDTSA--HPEVQKPNQFLLGVILTAQLPLWSPTSIMRGVNQRLLSQCMEYFDLRCQ 1534

  Fly  1503 TLSYGCIYNWPLQISE---------GLLGDEIKWLQRIRENVHATGDTQVHEE---LLEGHLCLA 1555
            .|.       .|..||         .:|.|||.||.....|  .|.|.:..|.   ||.|||.|.
Mouse  1535 LLD-------DLTTSEMDQLRISPATMLEDEITWLDNFEPN--RTADCETSEADNILLAGHLRLI 1590

  Fly  1556 KELMFFLGADSKAQLNELIHELIDDFLFTASREFLHLRRHGS----LRQDTVPPPVCRSPHTIAA 1616
            |.|:...||:.:...:.||..|:|||||.|||..::.....|    .:||.  .|.|.:.::..|
Mouse  1591 KTLLSLCGAEKEMLGSSLIKPLLDDFLFRASRIIVNSHSPASSAAISQQDF--HPKCSTVNSRLA 1653

  Fly  1617 ACDLLIALCQLCVPNMKLLTNTLIDFVCTDTDP--LREWDYLPPVGARPTKGFCGLKNAGATCYM 1679
            |.::|:.|......|::::|..|:. :....||  .:|:||||||.:|.:.||.||:|.||||||
Mouse  1654 AYEVLVMLADSSPSNLQIITKELLS-MHHQPDPALTKEFDYLPPVDSRSSSGFVGLRNGGATCYM 1717

  Fly  1680 NSVLQQLYMVPAVRVGILRAHGAATTDGEDFSGDSDLTGGGLGSALFSGPASALVSLPSSSSTIE 1744
            |:|.|||||.|                                     |...:|:|:...:...:
Mouse  1718 NAVFQQLYMQP-------------------------------------GLPESLLSVDDDTDNPD 1745

  Fly  1745 DGLHDVRKNYHVVILKHVQAIFAHLGHSALQYYVPRGLWTHFKLLGEPVNLREQQDAVEFFMSLL 1809
            |.           :...||::|.||..|.||||||...|..||:..:.:.:||||||.|||.||:
Mouse  1746 DS-----------VFYQVQSLFGHLMESKLQYYVPENFWKIFKMWNKELYVREQQDAYEFFTSLI 1799

  Fly  1810 ESLDEGLKALGQPQLMNATLGGSFSDQKICQECPHRYSKEEPFSVFSVDIRNHSSLTESLEQYVK 1874
            :.:||.||.:|:.|:...|..|.:||||||::|||||.:||.|...::.:.:..||..||:|:|:
Mouse  1800 DQMDEYLKKMGREQIFKNTFQGIYSDQKICKDCPHRYEREEAFMALNLGVTSCQSLEISLDQFVR 1864

  Fly  1875 GELLEGADAYHCDKCDKKVVTVKRVCVKKLPPVLAIQLKRFEYDYERVCAIKFNDYFEFPRILDM 1939
            ||:|||::||:|:||.:|.:||||.|:|.||.||.|.|.||.:|:|...:||:::...||.:|:|
Mouse  1865 GEVLEGSNAYYCEKCKEKRITVKRTCIKSLPSVLVIHLMRFGFDWESGRSIKYDEQIRFPWMLNM 1929

  Fly  1940 EPYTVSGLAKLEGEVVEVGDNCQTNVE-------------TTKYELTGIVVHSGQASGGHYFSYI 1991
            |||||:|:|:.:.. .|||:|.: |::             |..|||.|::||||||..|||:|:|
Mouse  1930 EPYTVAGMARQDSS-SEVGENGR-NMDQGGGGSPRKKVALTENYELVGVIVHSGQAHAGHYYSFI 1992

  Fly  1992 LSKNPANGKCQWYKFDDGEVTECKMHEDEEMKAECFGGEYMGETYDNNLKRMQYRRQKRWWNAYM 2056
            ..:... ||.:||||:|..:.|..:: ||.::.|||||||..:.||........||  |:|||||
Mouse  1993 KDRRGC-GKGKWYKFNDTVIEEFDLN-DETLEYECFGGEYRPKVYDQTNPYTDVRR--RYWNAYM 2053

  Fly  2057 LFYTR-CDQ-----------------------------------TPVQYEPSVEQLSL------- 2078
            |||.| .||                                   :|..:.|:.::||:       
Mouse  2054 LFYQRVSDQNSPVLPKKSRVSVVRQEAEDLSLSAPSSPEISPQSSPRPHRPNNDRLSILTKLVKK 2118

  Fly  2079 AESRNM-VLPLPKPIERSVRHQNIRFLHSRSIFSVEFFNFIKKLVSCNLLSARSNKITPAAEELS 2142
            .|.:.: |..:|..|.:.||.:|::|:.:|.::|.::|:|:..|.|.|....: :...|...::|
Mouse  2119 GEKKGLFVEKMPARIYQMVRDENLKFMKNRDVYSSDYFSFVLSLASLNATKLK-HPYYPCMAKVS 2182

  Fly  2143 LLGVQLASQFLFHTGFRTKKSLRGPVMEWYDALSHHIRSSALVRKWFANHALLSPPSRLGEYILM 2207
            |   |||.||||.|..||||.||....||...:...:..|....:|...:.:.|....|.:..|:
Mouse  2183 L---QLAIQFLFQTYLRTKKKLRVDTEEWIATIEALLSKSLDACQWLVEYFISSEGRELVKVFLL 2244

  Fly  2208 APS-PDVR----TVFVKLVVFFCHFAINDEPLTGYDGANLCEQVLISVLRLLKSEAADYGKHLPH 2267
            ..| .:||    |:..|.:         |..|...|......|:|..:|.||..:..:..|:...
Mouse  2245 ECSVREVRVAVATILEKTL---------DSALFYQDKLKSLHQLLEVLLALLDKDVPENCKNCAQ 2300

  Fly  2268 YFSLFSMYV-GLGTREKQQLLR-----------LNVPLQFIQVALDDGPGPAIKYQYPEFSKLHQ 2320
            |||||:.:| ..|.|....|||           |.|..|..|:......      |..||..||.
Mouse  2301 YFSLFNTFVQKQGIRAGDLLLRHSALRHMISFLLGVSRQNSQIRRWSSA------QAREFGNLHN 2359

  Fly  2321 VVSHLIRCSDVSEKCQSSNQNARPLSNPFKD-PNVA---HEELTPLSTECMDLLFNRTG--YIKK 2379
            .|:.|:..|||     ||.:|..|  ..||. |.::   ...|.||..|...|||...|  |:.:
Mouse  2360 TVALLVLHSDV-----SSQRNVAP--GIFKQRPPISVAPSSPLLPLHEEVEALLFLSEGKPYLLE 2417

  Fly  2380 VI----EDTNVGDEGLKLLQYCSWENPHFSRAVLTELLWQCGFAYCHDMRHHTDLLLNILLIDDS 2440
            |:    |.|......::::.||.:.|.|||..:|..:..|...|..|::::...||..:|:|:|.
Mouse  2418 VMFALRELTGSLLALMEMVVYCCFCNEHFSFTMLHFIKNQLETAPPHELKNTFQLLHEVLVIEDP 2482

  Fly  2441 WQHHRIHNALNGVAEEREGLLETIQRAKTHYQKRAYQIIKCLTQLFHKSPIALQMLHTNSNITRH 2505
            .|..|:    ..|.|...|||..:..:......|.||.:|.|..|..|.|.|.:....||:   |
Mouse  2483 IQVERV----KFVFETENGLLALMHHSNHVDSSRCYQCVKFLVTLAQKCPAAKEYFKENSH---H 2540

  Fly  2506 WSIAVEWLQGELDRQRGIGCQYNSYSWSPPAQ-SNDNTNGYMLERSQSAKNTWSMAFELCPDEVS 2569
            ||.||:|||.::          :.:.|:|.:. ||:.:.|...:|:.||::|.:.|..|    ::
Mouse  2541 WSWAVQWLQKKM----------SEHYWTPQSNVSNETSTGKTFQRTISAQDTLAYATAL----LN 2591

  Fly  2570 EKTDENNEPNLETNMDENKSEPVAQPGGVLEGSTGGTEQLPENK 2613
            ||..                          .||:.|:|..|.|:
Mouse  2592 EKEQ--------------------------SGSSNGSESSPANE 2609

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fafNP_524612.2 peptidase_C19C 1666..2064 CDD:239124 170/412 (41%)
UCH 1668..2059 CDD:278850 165/404 (41%)
Usp24XP_006503239.1 UBA_UBP24 6..42 CDD:270472
peptidase_C19C 1704..2061 CDD:239124 169/411 (41%)
UCH 1706..2056 CDD:278850 165/404 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5077
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D22076at33208
OrthoFinder 1 1.000 FOG0001696
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130114
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.