DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: faf and usp24

Sequence 1:NP_524612.2 Gene:faf FlyBaseID:FBgn0005632 Length:2778 Species:Drosophila melanogaster
Sequence 2:XP_005170208.1 Gene:usp24 ZFINID:ZDB-GENE-030131-4356 Length:2621 Species:Danio rerio

Alignment Length:2856 Identity:789/2857 (28%)
Similarity:1296/2857 (45%) Gaps:536/2857 (19%)


  Fly    30 TTTSPAQSAGSGSGIGTGTGTVANSSLPGGGSG-----SLDGNQDQQPA----TDSQSSDDVAAS 85
            |..||        |:|.|...:.:...||.|.|     ::.|..|..||    .:|:.|:|...:
Zfish    43 TNESP--------GLGYGYEPMESGPSPGSGDGENSGRTVTGGFDPPPAYHDVVESERSNDENGN 99

  Fly    86 LSANSVDSTITIVPPEKLISSFPTTKLRSLTQKISNPRWVVPVLPEQELEVLLNAAIELTQAGVD 150
            .|.||::              ||||.|..|..::....|.:|...|:.|...|.|:..|.:.|:.
Zfish   100 CSGNSME--------------FPTTNLYELESRVFTDHWSIPYKREESLGKCLIASTCLARHGLA 150

  Fly   151 HDCEPCVEFYRNGLSTSFAKILTDEAVNSWKNNIHHCILVSCGKLLHLIAIHMQRDNPY---LLD 212
            ...|.|..|....:..:|.|:||..||:.|...||..|......|:.|:|..:::| |.   |:.
Zfish   151 DADENCKRFIDRCMPEAFKKLLTSSAVHKWGTEIHEGIYNMLMLLVDLVAERVKQD-PIPIGLMG 214

  Fly   213 LLAIVFDPENKFNTFNAGRQPECFAAPDYIWGQLDSNKMYARPPPE--PKNARGWLVDLINRFGQ 275
            :|.:.|:|:|:::..|  |...|......::|:   :.|:|..|..  .|...||||||:||||:
Zfish   215 VLTMAFNPDNEYHFKN--RMKACQRNWAEVFGE---DSMFAVSPSSSYQKEPHGWLVDLVNRFGE 274

  Fly   276 LGGFDNLLERFNIGLELLKRNQNKCTGKNISVEGRVENGAQDNRLTLALIHSLLRPFGQCYELLM 340
            :|||..:         ..|.||.:                    :.:..:.:|::|.|.|.|.|.
Zfish   275 MGGFTAI---------QCKLNQEE--------------------IEIGCVSALVQPLGVCAEYLN 310

  Fly   341 PATIAKYFMPTWNVVLDLLDSFTDEELKREVKPEGRNDYINGIVKSARLLASRLTGQEELIRDLE 405
            .:.:.....|..:.::..:.:..:::||     :.|...|..::.:.:||..|.  |.||:..::
Zfish   311 SSLVQPMLDPVIHKMITYVQNLEEKDLK-----DKRLVSIPELLSAIKLLCMRF--QRELVNVVD 368

  Fly   406 MFRLKMILRLLQVSSFNGKMNALNEINKVLSSVAYFSHRSQPLPHCMPEDEMDWLTADRMAQWIK 470
            ..||.::||:|:...|:.|||:|.|:.|::..    |..|:.:.:.        :..||:..|:.
Zfish   369 DLRLDILLRMLKTPHFSAKMNSLKEVTKLIEE----STVSKTVKNA--------IDTDRLLDWLV 421

  Fly   471 SSDVLGVVLKDSLHQPQYVEKLEKIIRFLIKEQALTLDDLDAVWRAQAGKHEAIVKNVHDLLAKL 535
            .:.||.:.|:.::.|.||.::::.||..|  ...|:||:|..:|:.|||:...:::|:|.::|..
Zfish   422 ENSVLSIALEGNIDQAQYCDRIKGIIELL--GSKLSLDELSKIWKIQAGQSSTVIENIHTIIAAA 484

  Fly   536 AWDFTPEQLDHLFEAFQASMTTANKRQRERLLELIRRLAEDDKNGVMAQKVLKLFWTLAHSQEVP 600
            |..|..:||.|||...|.|....:.|.|::||.||.|:..:.::.....|||::.|.|||...:|
Zfish   485 AVKFNFDQLSHLFVLIQKSWEVESDRVRQKLLSLIGRIGREARSEATTGKVLEVLWELAHLPTLP 549

  Fly   601 PEVLDQALGAHVKILD--YSCSQERDAQKTIWLDKCVDELK-------------------SGDG- 643
            ..::.|||..|:.||.  |:.   ::..|..::.||::::|                   :|.. 
Zfish   550 TSLVQQALEEHLTILSDAYAV---KETIKRNYIIKCIEDIKKMQIQEDSKSPSETQVSFLTGTWG 611

  Fly   644 -------------------WVLPALRLIRDICCLYDTTTNHAQRTQTSTNRQQVIERLQNDYSLV 689
                               ||:||||.:.:|      |.:..::|....:: .:|:.|:.::.:|
Zfish   612 KKKPSSLAKSSQQTNPQTVWVVPALRQLHEI------TRSFIKQTYQKQDK-SIIQDLKKNFEIV 669

  Fly   690 ILVTNSLTAYMEKVRQMVTDSPGLDATRILIDGRFPHHVQIAERLEFLKFLLKDGQLWLCADQAK 754
            .|:|.||.: ..::...|..|.||..: .|:|||:.:...:...|:||.|.|::..|:|..::||
Zfish   670 KLITGSLVS-CHRLAVSVAGSNGLSGS-TLVDGRYSYQEYLEGHLKFLAFFLQEASLYLVWNRAK 732

  Fly   755 QIWHCLAVNA-VFPADREECFRWFGKLMGEEPDLDPGINKDFFENNILQLDPHLLTESGIKCFER 818
            :||.||.... |...|||.||.||.|  |:. ||:..:.:..|:..||:|:|:.:|.:|...|:.
Zfish   733 EIWECLVSGMDVCELDREMCFEWFTK--GQH-DLESDVQQQLFKEKILKLEPYEITMNGFNLFKT 794

  Fly   819 FFKAVNSKEDKLKAIHRGYMLDNEDLIGKDYLWRV-ITTGGEEIASKAIDLLKEVS-TALGPRLQ 881
            ||:.||..:.:||.......::..||.|.|::||: :.:..|:||::||.|:...| ..|.|:::
Zfish   795 FFENVNLSDHRLKRQGTQLCVERLDLAGMDFIWRIAMESPDEDIANEAIQLIITYSYINLNPKMK 859

  Fly   882 ENIAEFHEMFIGECCSRLR-----------THYGNIVILGKTQLQEELDAPDQSDNTNDESKDSK 935
            ::....|:.||.:|..||.           ||    .:...|::......|..:.:....|:.||
Zfish   860 KDSVSLHKKFIADCYKRLEAASSALGGPTLTH----AVTRATKMLTATAMPTVATSVQSPSRSSK 920

  Fly   936 MRFIEAEKMCRILKVLQEYVKECDRSFSGDRVHLPLSRVTRGKNTILYIRFQNPGRSIDDMEIVT 1000
            :..||     |:|.:.:.||...:..:|..|..||......|....|:|.:::   :.|...:..
Zfish   921 LVIIE-----RLLLLAERYVITIEDLYSVPRTILPHGASFHGHPVTLHITYES---TKDTFTLEA 977

  Fly  1001 HSNETMAAFKRNLLKRIKGTSTANIKVDLFYANDEMIGVSDEINPLYQYTIRDKMNLTAKLTPVG 1065
            |||||:.:.:..:..:: .....|:::   :|||.|:.::.:...|.|....|:.:||.|.:..|
Zfish   978 HSNETIGSIRWKIADQL-SCPVDNVQI---FANDSMLTMNRDQKLLNQLGFSDEQSLTVKSSGTG 1038

  Fly  1066 TGLASSPDSSSDSSTGSPPRPCPDMQRVESESTLPGVIISQNYQYTEFFLKLYQLGSDLEHGRLR 1130
            |...||.|||:.:|:.| .........:|.|.:||||:::   .....|..|||| ::||..|:.
Zfish  1039 TPSGSSADSSASASSSS-SGVFNSAYALEQEKSLPGVVMA---LVCNVFEMLYQL-ANLEEPRIT 1098

  Fly  1131 DSAKVLLHLLPCDRQTIRQLKIMCKVPKAA------VTVAVTGDKIAKDEEEKLYPTEQAGIEDE 1189
            ...:.||.|:|.|.:....|...  |||.:      .|:...|......:...|...:|   ..:
Zfish  1099 LRVRKLLLLIPTDPEVQDALDNF--VPKESSVWSHQKTLFTLGSGSQASKSPSLSSKQQ---HQQ 1158

  Fly  1190 EEHCTPEQMFLHPTPA----QVLYNLSVLHGLLIPALDPLGESALLVQSAWMHSGCAHF------ 1244
            ......|.:|....|.    :|||||.||...|:|..|  .|.|    ...:.|.|.:|      
Zfish  1159 SAASILESLFRSSAPGMSTFRVLYNLEVLSSKLMPTSD--DEMA----KTSVKSFCENFLKAGGL 1217

  Fly  1245 --VLELLTKNNFLPSADMHTKRASFQCVLRLAKLFLYIVGSVLSRVGDEPMICDLDNGSR----- 1302
              |:.::.:::.....|..|::..:...|:||:..|  ||..:..:.||.:..|....||     
Zfish  1218 SLVVNVMQRDSIPSEVDYETRQGVYSICLQLARFLL--VGQAMPSILDEELSKDDTLSSRPFRNA 1280

  Fly  1303 -----SQVDIL----KQNFSTMPSSSQGTLRAISAKLAVILAREMLSASPEGDRCRTLFSSTLQW 1358
                 .|:.:.    |.::..:..|.:.::|   .:..:..||..:.....||     |:     
Zfish  1281 GRQSGRQLSVCGTPEKSSYRQVSVSDRSSIR---VEEIIPAARVAIQTMEVGD-----FT----- 1332

  Fly  1359 SCPDISTIKAVVQLAWASSCGNLQALG--------------------------NSSGDFEDEVIV 1397
                 ||:...::|.||::.|.|..:|                          |.|...|.||..
Zfish  1333 -----STVACFMRLTWAAAAGRLDLVGSSQPIRETTNSLLPLGVRSRVSSTGSNCSSSSEGEVTT 1392

  Fly  1398 PDG-----------QDFSMCKEALEVLT----------ISFILNPSANEALTSDPNWPKFITSIV 1441
            ...           :|..:.:|||.:|.          .||....|.|:          ||..|:
Zfish  1393 LQAGICVKQLFVSIKDTIIAREALSLLVTCLQLRSQQLCSFYSLLSVND----------FIIDIL 1447

  Fly  1442 LKNPLRHVRQVASEQLFLAS---TYCAGD-RRPFVYMVNLLVGA----------LKTLVPQYEST 1492
            |.:|...:|:||.:||:..|   |....| ::|.::::.:::.|          ::.:..:..|.
Zfish  1448 LGSPSGEIRRVACDQLYTLSQSDTSAYPDLQKPNLFLLKVVLTAQLPLWSPTSIMRGVNQRLLSQ 1512

  Fly  1493 CAEFFSVLCRTLSYGCIYNWPLQISE---------GLLGDEIKWLQRIRENVHATGDTQVHEE-- 1546
            |.|:|.:.|:.|.       .|..||         .:|.|||.||    :|...|..|::...  
Zfish  1513 CTEYFDLRCQLLD-------DLTTSEMEQLQIGPAAMLEDEISWL----DNFEPTWTTELETSEA 1566

  Fly  1547 ---LLEGHLCLAKELMFFLGADSKAQLNELIHELIDDFLFTASREFLHLRRHGSLRQDTVP-PPV 1607
               ||.|||.|.|.|:...|.:.:.....||.:|:|||||.|||..|:.....|....... .|.
Zfish  1567 DNILLAGHLRLIKTLLSLCGTEKEQFGPSLIQQLLDDFLFRASRIILNSDSSSSTTASIHDFHPK 1631

  Fly  1608 CRSPHTIAAACDLLIALCQLCVPNMKLLTNTLIDFVCTDTDP--LREWDYLPPVGARPTKGFCGL 1670
            |.:..:..||.::|:.|....:.|::|:|..|:. :...:||  .:|:||||||.:|...||.||
Zfish  1632 CSTVSSRLAAYEVLVMLADSSLTNLQLITKELLS-MHHQSDPSLSKEFDYLPPVDSRSISGFVGL 1695

  Fly  1671 KNAGATCYMNSVLQQLYMVPAVRVGILRAHGAATTDGEDFSGDSDLTGGGLGSALFSGPASALVS 1735
            ||.|||||||:|.|||||.|.:..|:|                                      
Zfish  1696 KNGGATCYMNAVFQQLYMQPGLPEGVL-------------------------------------- 1722

  Fly  1736 LPSSSSTIEDGLHDVRKNYHVVILKHVQAIFAHLGHSALQYYVPRGLWTHFKLLGEPVNLREQQD 1800
                  :|||...:..::    :...||::|.||..|.||||||...|..||:..:.:.:|||||
Zfish  1723 ------SIEDDTENPEES----VFCQVQSLFGHLMESKLQYYVPENFWKIFKMWNKELYVREQQD 1777

  Fly  1801 AVEFFMSLLESLDEGLKALGQPQLMNATLGGSFSDQKICQECPHRYSKEEPFSVFSVDIRNHSSL 1865
            |.|||.||::.|||.||.:|:.|:...|..|.|||||||::|||||.:||.|...::.:.:..||
Zfish  1778 AYEFFTSLVDQLDEHLKKIGREQIFKNTFQGIFSDQKICKDCPHRYEREETFMALNLGVTSCQSL 1842

  Fly  1866 TESLEQYVKGELLEGADAYHCDKCDKKVVTVKRVCVKKLPPVLAIQLKRFEYDYERVCAIKFNDY 1930
            ..||:|:|:||:|:|::||:|:||.:|..||||.|:|.||.||.|.|.||.:|:|...:||:::.
Zfish  1843 EISLDQFVRGEVLDGSNAYYCEKCKEKRTTVKRTCIKSLPSVLVIHLMRFGFDWESGRSIKYDEQ 1907

  Fly  1931 FEFPRILDMEPYTVSGLAKLE--------GEVVEVGDNCQTNVETT---KYELTGIVVHSGQASG 1984
            ..||.:|:||||||||:|:.:        |...|.|.......:.|   .|||.|:|||||||..
Zfish  1908 IRFPWVLNMEPYTVSGMARQDSSADHGENGRGGEAGSGGSPRKKVTISENYELVGVVVHSGQAHA 1972

  Fly  1985 GHYFSYILSKNPANGKCQWYKFDDGEVTECKMHEDEEMKAECFGGEYMGETYDNNLKRMQYRRQK 2049
            |||:|:|..:. .:.:.:||||:|..|.|..|: ||.::.|||||||..:.||.:......||  
Zfish  1973 GHYYSFIKDRR-GSARGRWYKFNDNVVEEFDMN-DETLEYECFGGEYRPKVYDQSNPYPDVRR-- 2033

  Fly  2050 RWWNAYMLFYTR-CDQ-TPVQYEPS--------VEQLSLA------------------------- 2079
            |:||||||||.| .|| :||..:.|        .|.|||:                         
Zfish  2034 RYWNAYMLFYQRISDQNSPVLPKKSRVSIMRQEAEDLSLSAPSSPEISPQSSPRPPRANNDRLTL 2098

  Fly  2080 --------ESRNM-VLPLPKPIERSVRHQNIRFLHSRSIFSVEFFNFIKKLVSCNLLSARSNKIT 2135
                    |.:.: |..:|..|.:.||.:|::|:.:|.:::.::|:|...|.|.|     :.|:.
Zfish  2099 LTRLVKKGEKKGLFVEKMPARIFQMVRDENLKFMKNRDVYNSDYFSFTLSLASVN-----ATKLK 2158

  Fly  2136 PAA-EELSLLGVQLASQFLFHTGFRTKKSLRGPVMEWYDALSHHIRSSALVRKWFANHALLSPPS 2199
            .|: :.::...:|||.|||.||..||||.||....||...:...:..|:...:|...: |::|..
Zfish  2159 HASYQAMAKTSLQLAVQFLLHTYLRTKKKLRVDTEEWIATVEVLLSKSSEACQWMVQY-LVAPEG 2222

  Fly  2200 R--LGEYILMAPSPDVRTVFVKLVVFFCHFAINDEPLTGYDGANLCEQVLISVLRLLKSEAADYG 2262
            |  :...:|.....:||.|...::......|:.      :..|.| :.:|..:|.||..:..|..
Zfish  2223 REIIKICLLECSVREVRVVVATILEKTLESALY------FQDAGL-DCLLDMLLSLLDKDVPDNC 2280

  Fly  2263 KHLPHYFSLFSMYVGLGTREKQQLLRLNVPLQFIQVALDDGPGPA-------IKYQYPEFSKLHQ 2320
            |:...||||||.:...|....|.||:.:...:.:...|  ||...       ...|..||..||.
Zfish  2281 KNCSQYFSLFSNFAQRGCGPCQLLLKHSAYRRMLVFLL--GPNRQNNQHRRWSSAQAREFLHLHN 2343

  Fly  2321 VVSHLIRCSDVSEKCQSSNQNARPLSNPFKDPNVAHEELTPLSTECMDLLFNRTG--YIKKVI-- 2381
            .::.::..:|::.:...:....:..|:....|:   ..|.||..:...|||...|  |:.:|:  
Zfish  2344 TLALMVLHTDLTSQRTEAQGVFKQASSGLVAPS---SVLMPLHPDINTLLFKADGQAYLMEVMFA 2405

  Fly  2382 --EDTNVGDEGLKLLQYCSWENPHFSRAVLTELLWQCGFAYCHDMRHHTDLLLNILLIDDSWQHH 2444
              |.:......::::.|.|:.|..||..||..|......|..|::::...:||.||:::|..|..
Zfish  2406 MRELSGPLSFLIEMITYSSFCNEPFSLGVLQLLKNHLETAPPHELKNVFQMLLEILMLEDPLQSQ 2470

  Fly  2445 RIHNALNGVAEEREGLLETIQRAKTHYQKRAYQIIKCLTQLFHKSPIALQMLHTNSNITRHWSIA 2509
            |:..|.    |..:|||..:.::......|.||.:|.|..|..|...|....   ..::.|||.|
Zfish  2471 RLKFAF----ESEKGLLALMHQSNNVDSSRCYQCVKFLVTLAQKCSPAKDYF---KELSGHWSWA 2528

  Fly  2510 VEWLQGELDRQRGIGCQYNSYSWSPPAQ-SNDNTNGYMLERSQSAKNTWSMAFELCPDEVSEKTD 2573
            |:|||.::          :.:.|:|.:. ||:.:.....:|:.||::|.:.|..|    ::||  
Zfish  2529 VQWLQKKM----------SEHYWTPQSNVSNETSTAKTFQRTISAQDTLAYATAL----LNEK-- 2577

  Fly  2574 ENNEPNLETNMDENKSEPVAQPGGVLEGSTGGTEQLPENKTPTTSSPSTAAWPAR-GDSNA 2633
                       |::             ||:.|::..|.|:....|....:..|.. |||.:
Zfish  2578 -----------DQS-------------GSSNGSDGSPANENSDRSLRQGSESPMMLGDSRS 2614

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fafNP_524612.2 peptidase_C19C 1666..2064 CDD:239124 173/410 (42%)
UCH 1668..2059 CDD:278850 168/402 (42%)
usp24XP_005170208.1 UBA_UBP24 7..43 CDD:270472 789/2857 (28%)
peptidase_C19C 1691..2048 CDD:239124 172/409 (42%)
UCH 1693..2043 CDD:278850 168/402 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5077
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D22076at33208
OrthoFinder 1 1.000 FOG0001696
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130114
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.