DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: faf and Usp7

Sequence 1:NP_524612.2 Gene:faf FlyBaseID:FBgn0005632 Length:2778 Species:Drosophila melanogaster
Sequence 2:NP_572779.2 Gene:Usp7 FlyBaseID:FBgn0030366 Length:1129 Species:Drosophila melanogaster

Alignment Length:1066 Identity:224/1067 (21%)
Similarity:362/1067 (34%) Gaps:384/1067 (36%)


  Fly  1653 WDYLPPVGARPTKGFCGLKNAGATCYMNSVLQQLYMVPAVRVGILRAHGAATTDGEDFSGDSDLT 1717
            ||      ::...|:.||||.||||||||:||.||...::|:.:.|    ..|:.:|        
  Fly   232 WD------SKKHTGYVGLKNQGATCYMNSLLQTLYFTNSLRLSVYR----IPTEADD-------- 278

  Fly  1718 GGGLGSALFSGPASALVSLPSSSSTIEDGLHDVRKNYHVVILKHVQAIFAHLGHSALQYYVPRGL 1782
                             |..|...:::...|:::.....|..|.:...|.               
  Fly   279 -----------------SSKSVGLSLQRVFHELQFGDRPVGTKKLTKSFG--------------- 311

  Fly  1783 WTHFKLLGEPVNLREQQDAVEFFMSLLESLDEGLKALGQPQLMNATLGGSF----SDQKICQECP 1843
            |       |.::...|.|..||...||:.|:..:|.    .::..|:.|.|    |....|:...
  Fly   312 W-------ETLDSFMQHDVQEFLRVLLDKLESKMKG----TILEGTIPGLFEGKMSSYIKCKNVD 365

  Fly  1844 HRYSKEEPFSVFSVDIRNHSSLTESLEQYVKGELLEGADAYHCDKCDKKVVTVKRVCVKKLPPVL 1908
            :..::.|.|....::|::..::.||.:.||..|.|||.:.|.......:..: |.|.....||||
  Fly   366 YNSTRYETFYDIQLNIKDKKNIYESFQDYVAPETLEGDNKYDAGVHGLQEAS-KGVIFTSFPPVL 429

  Fly  1909 AIQLKRFEYDYERVCAIKFNDYFEFPRILDMEPYTVSGLAKLEGEVVEVGDNCQTNVETTKYELT 1973
            .:.|.||:||.....:||:||.|||...::::.|    ||:.|..:.:             |.|.
  Fly   430 HLHLMRFQYDPVTDSSIKYNDRFEFYEHINLDRY----LAESENTLAD-------------YVLH 477

  Fly  1974 GIVVHSGQASGGHYFSYILSKNP-ANGKCQWYKFDDGEVTECKMHEDEEMKAECFGGEYMGETYD 2037
            .::||||...||||..:|   || |:|:  |:||||..|:.|:..|..|..   :||  |.:...
  Fly   478 AVLVHSGDNHGGHYVVFI---NPKADGR--WFKFDDDVVSSCRKQEAIEQN---YGG--MDDEIS 532

  Fly  2038 NNLKRMQYRRQKRWWNAYMLFYTRCDQTP------VQYEPS---VEQLSLAESRNMVLPLPKPIE 2093
            .:.|..         |||||.|.|..:..      .:.|.|   ||:|.| |.|   :.:.:..|
  Fly   533 FHAKCS---------NAYMLVYIRQSELDRVLGDITESEISSDLVERLDL-EKR---IEMARRKE 584

  Fly  2094 RS----------VRHQNIRFLHSRSIFSVEFFNFIKKLVSCNLLSARSNKITPAAEELSLLGVQL 2148
            |.          :..:|....|.|.:|.:|                   |:.|..          
  Fly   585 RGEANTYVSVHVILEENFEEQHKRRLFDLE-------------------KVHPRV---------- 620

  Fly  2149 ASQFLFHTGFRTKKSLRGPVMEWYDALSHHIRSSALVRKWFANHALLSPPSRLGEYILMAPSPDV 2213
                     ||.|::                                                  
  Fly   621 ---------FRIKQN-------------------------------------------------- 626

  Fly  2214 RTVFVKLVVFFCHFAINDEPLTGYDGANLCEQVLISVLRLLKSEAADYGKHLPHYFSLFSMYVGL 2278
            :||...:.:|...|.::.:.:..:   |||              .|...|     ||.|. :|..
  Fly   627 QTVDELVDLFVRGFGVSRQRMRMW---NLC--------------TAQTQK-----FSHFD-FVAE 668

  Fly  2279 GTREKQQLLRLNVP-LQFIQVALDDGPGPA------------IKYQYPEFSKLHQV----VSHLI 2326
            |:|..:|:.....| :.::|:|..|.|||.            :||..|...:|:.:    ..|..
  Fly   669 GSRTIEQISTSQKPWVIWLQLAWTDVPGPLPPFNPKTESLLFLKYYDPRNKRLNYIGCTQQPHTR 733

  Fly  2327 R----CSDVSEKCQSSNQNARPLSNPFKDPNVAHEELTPLSTECMDLLF----NRTGYIKKVIED 2383
            |    ..||:.|..........:.:.:.|     ::|..|:......||    :..|:| .:.|.
  Fly   734 RLIDLVPDVNSKLGFEPDTELTIYDEYAD-----KKLVNLNEPIESALFIPQDHLQGHI-LIFER 792

  Fly  2384 TN---------VGDEGLKLL--------QYCSWENPHFSRAVLTELLWQCGFAYCHDMRHHTDLL 2431
            .|         |||..|.|:        ..|:...|.|:                          
  Fly   793 ENVDAKLDLPTVGDYFLDLVYRIEIIFSDKCNPNEPDFT-------------------------- 831

  Fly  2432 LNILLIDDSWQHHRIHNALNGVAEEREGLLETIQRAKTHYQKRAYQIIKCLTQ----------LF 2486
               |.:.:.:.:.::.||   |||          |..|..||  .|...|:..          ..
  Fly   832 ---LELSNRYNYDQLANA---VAE----------RLNTDPQK--LQFFMCINNYKETAGNAVPYT 878

  Fly  2487 HKSPIALQMLHTNSNITR-----HWSIAVEWLQGELDRQRGIGCQYNSYSWSPPAQ------SND 2540
            .|..|...:.:|..:.|:     ..|:::.    |||.::...|.:.|.......:      .||
  Fly   879 FKGTIKDLVSYTKQSSTKRIFYQRLSLSIH----ELDNKKQFKCVWVSSDLKDEKELVLYPNKND 939

  Fly  2541 NTNGYMLERSQS---AKNTW----------SMAFELCPDEVSEKTDENNEPNLETNMDENKSEPV 2592
            ...|.:.|.::.   |:|:.          .....:|.|::.          |:|.:..|:|...
  Fly   940 TVKGLLEEAAKKISFAENSRRKLRLLKISNHKIVAVCKDDIP----------LDTLLKSNESITT 994

  Fly  2593 AQPGGV-----LEGSTGGTEQLPENK 2613
            ||  |.     :|.......||.||:
  Fly   995 AQ--GAQKTFRIEEVPAEDMQLAENE 1018

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fafNP_524612.2 peptidase_C19C 1666..2064 CDD:239124 111/403 (28%)
UCH 1668..2059 CDD:278850 108/396 (27%)
Usp7NP_572779.2 MATH_HAUSP 100..229 CDD:239741
COG5077 101..1119 CDD:227409 224/1067 (21%)
peptidase_C19C 239..549 CDD:239124 111/402 (28%)
USP7_ICP0_bdg 647..886 CDD:289221 59/312 (19%)
USP7_C2 897..1113 CDD:291217 26/139 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C127929653
eggNOG 1 0.900 E1_COG5077
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24006
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.