DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: faf and Usp16-45

Sequence 1:NP_524612.2 Gene:faf FlyBaseID:FBgn0005632 Length:2778 Species:Drosophila melanogaster
Sequence 2:NP_001284890.1 Gene:Usp16-45 FlyBaseID:FBgn0029763 Length:1126 Species:Drosophila melanogaster

Alignment Length:1292 Identity:249/1293 (19%)
Similarity:382/1293 (30%) Gaps:480/1293 (37%)


  Fly   918 LDAPDQSDNTNDESKDSK--MRFIEAEKMCRILK---VLQEYVKECDR--SFSGDRVHLPLSR-- 973
            |.:|.|||.....:...:  .:.::|.::.|:||   :|.| ..:|.:  ..:|.......|.  
  Fly    29 LGSPGQSDGATPTTASCQHIKKAVDAARLRRLLKSTGLLYE-CSQCQKLGKTAGSAAGAGASEGA 92

  Fly   974 VTRGKNTILY--------------------------IRFQNP----------GRSID------DM 996
            |..|.|.:.:                          ..:|.|          .||.|      ||
  Fly    93 VGPGGNPVTFEFDNTLWLCLKCGSQLCGRARHKHALEHYQTPHSDSHALAMNTRSFDIWCYECDM 157

  Fly   997 EIVTHSNETMAAFKRNLLKRIK---------GTSTANIKVDLFYANDEMIGVSDEINPLYQYTIR 1052
            :|.::       .::|||:.::         .|||..                 ...|...| |.
  Fly   158 KICSN-------LRKNLLECVELVKKLAQKPPTSTVT-----------------PSTPTISY-IE 197

  Fly  1053 DKMNLTAK-LTPV--GTGLASSPDSSSDSS---------TGS-----------PPRPCPDMQRVE 1094
            :|:....: |||:  .|| .|..||||..|         .||           ||.|...:...:
  Fly   198 EKLKAALEHLTPIVPMTG-GSFDDSSSRGSLAAAGGGGGVGSSRNRQVAIPMPPPEPSSGLSTSD 261

  Fly  1095 SESTLPGVIISQNYQYTEFFLKLYQLGSDLEHGRLRDSAKVLLHLLPCDRQTIRQLKIMCKVPKA 1159
            |.:::|| :..:..||                                                :
  Fly   262 SLTSVPG-MAKRIDQY------------------------------------------------S 277

  Fly  1160 AVTVAVTGDKIAKDEEEKLYPTEQAGIEDEEEHCTPEQMFLHPTPAQVLYNLSVLHGLLIPALDP 1224
            |.|...||:|       :|...|...||:|.   .|.                      :..|..
  Fly   278 ATTNGNTGNK-------RLLTLETPRIENER---LPR----------------------VRGLTN 310

  Fly  1225 LGESALLVQSAWMHSGCAHFVLELLTKNNFLPSADMHTKRASFQCVLRLAKLFLYIVGSVLSRVG 1289
            ||.:...                                .|..||:.:..  ||..|...||..|
  Fly   311 LGNTCFF--------------------------------NAVMQCLAQTP--FLLSVLKELSEPG 341

  Fly  1290 DEPMICDLDNGS---RSQVDI-LKQNFSTMPSSSQGTLRAISAKLAVILAREMLSASPEGDRCRT 1350
            :|.:   |..|:   :.:.|| |.....|:  ||.|.|.|     |:..|.|.|.|.......|.
  Fly   342 EEFI---LPGGTFTIKDKGDIELPMIKGTL--SSWGGLTA-----ALANALEELQAGGSVFTPRK 396

  Fly  1351 LFSSTLQWSCPDISTIKAVVQLAWASSCGNLQALGNSSGDFEDEVIVPDGQDFSMCKEALEVLTI 1415
            || ..|...||..                       :.||..|               |.|:|  
  Fly   397 LF-DRLCVKCPQF-----------------------TGGDQHD---------------AHELL-- 420

  Fly  1416 SFILNPSANEALTSDPNWPKFITSIVLKN---PLRHVRQVASEQLFLASTY--CAGDR--RPFVY 1473
            ..:|....||.|       |....::|:|   ..:.|..|:.|.......|  .||||  ||...
  Fly   421 RQLLESVRNEDL-------KRYQRVILQNLGYKDQDVNSVSEEMRQKCKIYGNQAGDRILRPEQV 478

  Fly  1474 MVNLLVGALKTLVPQYESTCAEFFSVLCRTLSYGCIYNWPLQISEGLLGDEIKWLQRIREN---- 1534
            ....||..|         ||.:..:|..|       :.:.|.:|..:..::.:..||.:.:    
  Fly   479 FRGFLVSTL---------TCQDCHNVSSR-------HEYFLDMSLPVAVEKPQPPQRRKPSPELS 527

  Fly  1535 --------VHATGDTQVHEELLEGHL-CLAKELMFFLGADSKAQL-------------------- 1570
                    ..:||...::.:..:|.: ..|....|||.|...|.|                    
  Fly   528 LTSSSSSVTPSTGQPTINTKFTDGSVNFTASSPSFFLHAHEAASLGPSKSQVKKEKERQRKAKRA 592

  Fly  1571 -------------------NELIHELIDDFLFTASREFLHLRRHGSLRQ------DTVPPPVCRS 1610
                               |||...:..|....||......:.:..|.|      |:....|..|
  Fly   593 AKKRQKSSLNLNGNDSGNGNELAESVDQDDASLASLGAGDGQANDGLEQTNGQTEDSTTSSVTTS 657

  Fly  1611 PHTIAAACDLLIALCQLCVPNMKLLTNTLIDFVCTDTDPLREW-----DYLPPVGAR-------- 1662
            .|:.|...|.|:.  ....|:    ||.:.....:.|.|.:.:     :..||...|        
  Fly   658 EHSDADVEDNLVE--DTAAPS----TNNVPSSTASLTAPSKTYMDSNGNAQPPGEKRDDTPEHMD 716

  Fly  1663 -----PTKGFCGLKNAGATCYMNSVLQQLYMVPAVRVGILRAHGAATTDGEDFSGDSDLTGGGLG 1722
                 ..:...|:..:.|....||                      :|.......::.:.|.|| 
  Fly   717 KDSLEEDENDSGIATSPAPTATNS----------------------STSTSATGNNNSVAGSGL- 758

  Fly  1723 SALFSGPASALVSLPSSSSTIEDGLHDVRKNYHVVILKHVQAIFAHLGHSALQYYVPRGLWTHFK 1787
                ||.:.||....:.:|.:..||.:...:    :::.| ::.|..|.|               
  Fly   759 ----SGSSGALEDPLAPASLVTAGLSEKGAS----VIRQV-SVGAEQGAS--------------- 799

  Fly  1788 LLGEPVNLREQQDAVEFFMSLLESLDEGLKALGQPQLMNATL-GGSFSDQKICQECPHRYSKEEP 1851
                  |..|..|.....:...|......:|:.|.|.....: ..|:||..  .....||..|: 
  Fly   800 ------NGTEDADGEAKAIEQPEKTPSQAQAMAQAQARTKRVRTQSYSDWS--TTIAPRYQCED- 855

  Fly  1852 FSVFSVDIRNHSSLTESLEQYVKGELLEGADAYHCDKC-------DKKVVTV-----KRVCVKKL 1904
                     ...|:...|..:...||:.|.:...||.|       |.|..:|     |::.|...
  Fly   856 ---------GECSVQSCLNNFTAVELMTGQNKVGCDSCTQRINGSDPKAKSVNTNATKQLLVSSP 911

  Fly  1905 PPVLAIQLKRFEYDYERVCAIKFNDYFEFPRILDMEPYTVSGLAKLEGEVVEVGDNCQTNVETTK 1969
            |.||.:.||||:.. .|....|......:|.:||:..:..|.:..|        .|.....:...
  Fly   912 PAVLILHLKRFQLG-PRCIFRKLTRPVSYPNLLDIAAFCGSKVKNL--------PNIDRKQKKLL 967

  Fly  1970 YELTGIVVHSGQASGGHYFSYI-LSKNPANGKCQWYKFDDGEVTECKMHEDEEMKAE 2025
            |.|.|:|.|||...||||.:|: :....|.|..:|.....|...|....:|:..|.|
  Fly   968 YALYGVVEHSGGMYGGHYTAYVKVRPKVAPGDKRWKFLPHGSKAELDQDDDQLKKLE 1024

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fafNP_524612.2 peptidase_C19C 1666..2064 CDD:239124 80/375 (21%)
UCH 1668..2059 CDD:278850 80/373 (21%)
Usp16-45NP_001284890.1 zf-UBP 108..159 CDD:280334 7/51 (14%)
Peptidase_C19 307..>512 CDD:271592 67/313 (21%)
Peptidase_C19K <849..1123 CDD:239132 51/196 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C127930028
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.