DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: faf and Usp9y

Sequence 1:NP_524612.2 Gene:faf FlyBaseID:FBgn0005632 Length:2778 Species:Drosophila melanogaster
Sequence 2:NP_001316831.1 Gene:Usp9y RGDID:9087771 Length:2552 Species:Rattus norvegicus

Alignment Length:2647 Identity:1201/2648 (45%)
Similarity:1652/2648 (62%) Gaps:233/2648 (9%)


  Fly    27 TTTTTTSPAQSAGSGSGIGTGTGTVANSSLPGGGSGSLDGNQDQQPAT--DSQSSDDVAASLSAN 89
            |.||..||   .|.....|......:..|.......|.|.:.:..|||  |.|...|        
  Rat     2 TVTTRGSP---VGENESQGQAPDGQSQPSFQQNQISSSDSSNENSPATPPDEQGQGD-------- 55

  Fly    90 SVDSTITIVPP--EKLISSFPTTKLRSLTQKISNPRWVVPVLPEQELEVLLNAAIELTQAGVDHD 152
                    .||  |:...:||...|..|...|:.|||||||||:.||||||.|:|:||:.|:|..
  Rat    56 --------APPQHEEEDPTFPHADLAKLEDMINRPRWVVPVLPKGELEVLLEASIDLTKKGIDAK 112

  Fly   153 CEPCVEFYRNGLSTSFAKILTDEAVNSWKNNIHHCILVSCGKLLHLIAIHMQRDNPYLLDLLAIV 217
            .|.|..|:|:.|:.||.||||||||:.||..||.||:.:..:|:.|....:.:|....|:||||.
  Rat   113 SEACQRFFRDVLTVSFTKILTDEAVSGWKFEIHRCIINNTHRLMELCVAKLSQDWFPFLELLAIA 177

  Fly   218 FDPENKFNTFNAGRQPECFAAPDYIWGQLDSNKMYARPPPEPKNARGWLVDLINRFGQLGGFDNL 282
            .:|..||:.:|..|..|..::.    .|...::::| ..|:.::.:||||||||.||.|.||..|
  Rat   178 LNPHCKFHVYNGARPCESVSSS----VQFPEDELFA-CSPDLRSPKGWLVDLINTFGTLNGFQIL 237

  Fly   283 LERFNIGLELLKRNQNKCTGKNISVEGRVENGAQDNRLTLALIHSLLRPFGQCYELLMPATIAKY 347
            .:||..|                            :.|.:..|.:|::|||||.|.|...|:.||
  Rat   238 HDRFISG----------------------------SALNVQTIAALIKPFGQCCEYLTQHTLKKY 274

  Fly   348 FMPTWNVVLDLLDSFTDEELKREVKPEGRNDYINGIVKSARLLASRLTGQEELIRDLEMFRLKMI 412
            |:|...||..||...|:||||:|.|.|.:||.|:.|:|..:.||||:.||||.:::||:||||||
  Rat   275 FIPVIEVVPQLLQKLTNEELKKEAKTEVKNDAISMIIKFLKNLASRIPGQEETVKNLEIFRLKMI 339

  Fly   413 LRLLQVSSFNGKMNALNEINKVLSSVAYFSHRSQPLPHCMPEDEMDWLTADRMAQWIKSSDVLGV 477
            |||||:||||||||||||||||||||:|::||     |...|:|  ||||:|||:||:.:::|.:
  Rat   340 LRLLQISSFNGKMNALNEINKVLSSVSYYTHR-----HGNSEEE--WLTAERMAEWIQQNNILSI 397

  Fly   478 VLKDSLHQPQYVEKLEKIIRFLIKEQALTLDDLDAVWRAQAGKHEAIVKNVHDLLAKLAWDFTPE 542
            ||:|||||||||||||||:||:|||:||||.||:.:|.||||||||||||||||||||||||:||
  Rat   398 VLQDSLHQPQYVEKLEKILRFVIKEKALTLQDLNNIWAAQAGKHEAIVKNVHDLLAKLAWDFSPE 462

  Fly   543 QLDHLFEAFQASMTTANKRQRERLLELIRRLAEDDKNGVMAQKVLKLFWTLAHSQEVPPEVLDQA 607
            ||||||:.|:||.|.|:|:|||:|||||||||||||:||||||||.|.|.||||.:||.:::|.|
  Rat   463 QLDHLFDCFKASWTNASKKQREKLLELIRRLAEDDKDGVMAQKVLNLLWNLAHSDDVPVDIMDLA 527

  Fly   608 LGAHVKILDYSCSQERDAQKTIWLDKCVDELKSGDGWVLPALRLIRDICCLYDTTTNHAQRTQTS 672
            |.||:|||||||||:||.||..|:|..::|.::.:.||:|||:.|::||.|:.....:..:|..|
  Rat   528 LSAHIKILDYSCSQDRDTQKIQWIDCFIEEFRTNNKWVIPALKQIKEICSLFGEAPQNLSQTHRS 592

  Fly   673 TN---RQQVIERLQNDYSLVILVTNSLTAYMEKVRQMVTDSPGLDATRILIDGRFPHHVQIAERL 734
            .:   |..:|.:||::::||.||..:|..||..:|....|....|...|.:..|:.|..::.|||
  Rat   593 PHVFYRHDLISQLQHNHALVTLVAENLATYMNSIRLYARDHEDYDPQTIRLGSRYSHVQEVQERL 657

  Fly   735 EFLKFLLKDGQLWLCADQAKQIWHCLAVNAVFPADREECFRWFGKLMGEEPDLDPGINKDFFENN 799
            .||:||||||||||||.||||||||||.|||:.:|||.||.|:.||||:||||||.|||:|||:|
  Rat   658 NFLRFLLKDGQLWLCASQAKQIWHCLAENAVYFSDREACFMWYSKLMGDEPDLDPDINKEFFESN 722

  Fly   800 ILQLDPHLLTESGIKCFERFFKAVNSKEDKLKAIHRGYMLDNEDLIGKDYLWRVITTGGEEIASK 864
            :|||||.||||:||||||||||.||.:|.||....:.||:|:.||||.||||:|:....::|:::
  Rat   723 VLQLDPSLLTENGIKCFERFFKTVNCREGKLMIKRKVYMMDDLDLIGLDYLWKVVIQSNDDISNR 787

  Fly   865 AIDLLKEVSTALGPRLQENIAEFHEMFIGECCSRLRTHYGNIVILGKTQLQEELDAPDQSDNTND 929
            |||||||:.|:||||||.|....||.||..|..|:::.|..:.:|                   |
  Rat   788 AIDLLKEIYTSLGPRLQANQVVIHEDFIQSCFDRMKSSYDTLHVL-------------------D 833

  Fly   930 ESKDSKMRFI--EAEKMCRILKVLQEYVKECDRSFSGDRVHLPLSRVTRGKNTILYIRFQNPGRS 992
            ..||:.....  ||.::.|||.||:||:.|||..:..:|:.||:||..|||:..|.:||.|..:.
  Rat   834 SDKDNIFSCARQEAIRIVRILTVLREYISECDSDYHEERMILPMSRAFRGKHLSLTVRFPNQSKE 898

  Fly   993 IDDMEIVTHSNETMAAFKRNLLKRIKGTSTANIKVDLFYANDEMIGVSDEINPLYQYTIRDKMNL 1057
            :||::|::|:|.|:.:.:|.:|.||....| :.|::||... |:|...|:...:.|..::||..:
  Rat   899 VDDLDILSHTNATIGSVRRCILNRINANVT-HTKIELFIGG-ELIDSEDDRKLVEQLNLKDKSLI 961

  Fly  1058 TAKLTPVGTGLASSPDSSSDSSTGSPPRPC----PDMQRVESESTLPGVIISQNYQYTEFFLKLY 1118
            |||...:.:.:.||||||||||.|||...|    .|:...|.|:.|||||:|...:|..|..::.
  Rat   962 TAKFLQINSNMPSSPDSSSDSSAGSPGNHCHNNYRDVPNSEMENCLPGVIMSLQPRYISFLWQVA 1026

  Fly  1119 QLGSDLEHGRLRDSAKVLLHLLPCDRQTIRQLKIMCKVPKAAVTVAVTGDKIAKDEEEKLYPTEQ 1183
            .|||.|....|||.|::|:.|:|.|..||..|:.:|                          ::.
  Rat  1027 DLGSMLTMPTLRDGARILMKLMPPDNTTIENLRAVC--------------------------SDH 1065

  Fly  1184 AGIEDEEEHCTPEQMFLHPTPAQVLYNLSVLHGLLIPALDPLGESALLVQSAWMHSGCAHFVLEL 1248
            ..:.:.....:...:|...:.::|||...|::.||:||...|.:.:...|..::.:|....||.:
  Rat  1066 LNLGERRLGQSLHSLFFGSSASKVLYLTEVVYILLMPAGAHLADISSDFQYHFLKNGGLPLVLSM 1130

  Fly  1249 LTKNNFLPSADMHTKRASFQCVLRLAKLFLYIVG----SVLSRV------GDEPMICDLDNGSRS 1303
            |.:|||||:.|:.|:|.::...|::|||.|..:|    ..::..      |.:|. ..::..:..
  Rat  1131 LIQNNFLPNTDVETRRDAYFSALKIAKLLLTTIGYGHVQAIAEACQPVADGTDPK-TPINQATHD 1194

  Fly  1304 QVDILKQNFSTMPS-SSQGTLRAISAKLAVILAREMLSASPEGDRCRTLFSSTLQWSCPDISTIK 1367
            |..:|:....::|: ||:..||.:|.:||..::         |...|.:         |||..|:
  Rat  1195 QAVVLQNALQSIPNPSSECMLRNVSIRLAHQIS---------GLASRYI---------PDICVIR 1241

  Fly  1368 AVVQLAWASSCGNLQALGNSSGDFEDEVIV-------PDGQDFSMCKEALEVLTISFILNPSANE 1425
            |:.::.|.|.||:|:.:.:...|......:       |:.:|..:|.|||||:|:.|.|.|:|.:
  Rat  1242 AIQKIIWTSGCGSLELVFSPHEDITKTYKMTTSTRSNPEVKDEQVCCEALEVMTLCFALIPTALD 1306

  Fly  1426 ALTSDPNWPKFITSIVLKNPLRHVRQVASEQLFLASTYCAGDRRPFVYMVNLLVGALKTLVPQYE 1490
            :|:.:..|..|:..::|..|.:.:||:|.||.||..|.|....||.::.:.||...|.:...:..
  Rat  1307 SLSKEKAWQSFVIDLLLYCPSKTIRQLAQEQFFLICTRCCMGHRPLLFFITLLFTILGSAATEKG 1371

  Fly  1491 STCAEFFSVLCRTLSYGCIYNWPLQIS--EGLLGDEIKWLQRIRENVHATGDTQVHEELLEGHLC 1553
            .....:|.:|.|.|:|.  ||..:.|.  :.||.|||.||:|:|:.:..||:|.|.:.:|||||.
  Rat  1372 KHSDVYFPLLRRLLTYA--YNSNIHIPNVDVLLNDEINWLKRVRDYIKNTGETSVEDPILEGHLG 1434

  Fly  1554 LAKELMFFLGADSKAQLN------ELIHELIDDFLFTASREFLHLRRHGSL-RQDTVPPPVCRSP 1611
            :.|||:.|...|.|..:.      .|:.||||||:|.||:.:|...|.|.: .:.|:  |||.||
  Rat  1435 VTKELLSFQTPDKKYHIGCKAGGANLVKELIDDFIFPASKAYLQYSRSGEMPNKQTI--PVCGSP 1497

  Fly  1612 HTIAAACDLLIALCQLCVPNMKLLTNTLID--FVCTDTDPLREWDYLPPVGARPTKGFCGLKNAG 1674
            .|:.|..:||:||...||.|:|.:.|.|.:  ::.|..:.|.||:||||||.||.|||.||||||
  Rat  1498 ATVNAGFELLVALAFGCVRNLKQIVNCLTEMFYIGTPVNTLAEWEYLPPVGPRPPKGFVGLKNAG 1562

  Fly  1675 ATCYMNSVLQQLYMVPAVRVGILRAHGA-ATTDGEDFSGDSDLTGGGLGSALFSGPASALVSLP- 1737
            ||||||||:|||||:|::|..||..... ..||.:.|..:...:...:      .|...:...| 
  Rat  1563 ATCYMNSVIQQLYMIPSIRNSILAIENIWNDTDDDTFKDERQDSENNI------DPRDDVFGYPH 1621

  Fly  1738 -----SSSSTIEDGLHDVRKNYHVVILKHVQAIFAHLGHSALQYYVPRGLWTHFKLLGEPVNLRE 1797
                 .:.:..||     ||:|::.:|||:|..|.||..|.||||||||.|..|:|.||||||||
  Rat  1622 QFEDKPTLNKAED-----RKDYNIGVLKHLQITFGHLAASQLQYYVPRGFWQQFRLWGEPVNLRE 1681

  Fly  1798 QQDAVEFFMSLLESLDEGLKALGQPQLMNATLGGSFSDQKICQECPHRYSKEEPFSVFSVDIRNH 1862
            |.||:|||.||::||||..||||.|.|::..|||||:||||||.|||||..||.|:..:||||||
  Rat  1682 QHDALEFFNSLVDSLDEAFKALGHPTLLSKVLGGSFADQKICQGCPHRYECEESFTTLNVDIRNH 1746

  Fly  1863 SSLTESLEQYVKGELLEGADAYHCDKCDKKVVTVKRVCVKKLPPVLAIQLKRFEYDYERVCAIKF 1927
            .:|.:|||||:||:|||||:||||:||||||.||||:.:||||.|||||||||:||:||.|||||
  Rat  1747 QNLLDSLEQYIKGDLLEGANAYHCEKCDKKVDTVKRLLIKKLPSVLAIQLKRFDYDWERECAIKF 1811

  Fly  1928 NDYFEFPRILDMEPYTVSGLAKLEGEVVE-----VGDNCQT-NV--ETTKYELTGIVVHSGQASG 1984
            ||||||||.||||||||:|..||||:.|.     :..|.|: ||  .:|||.|.|::||||||:|
  Rat  1812 NDYFEFPRELDMEPYTVAGATKLEGDGVHPQTQLIKQNEQSENVVPGSTKYRLVGVLVHSGQANG 1876

  Fly  1985 GHYFSYILSKN-PANGKCQWYKFDDGEVTECKMHEDEEMKAECFGGEYMGETYDNNLKRMQYRRQ 2048
            |||:|||:.:| ..|.:.:|:|||||:||||||.:|||||.:|||||||||.:|:.:|||.||||
  Rat  1877 GHYYSYIIQRNGKDNNRGRWFKFDDGDVTECKMDDDEEMKNQCFGGEYMGEVFDHMMKRMSYRRQ 1941

  Fly  2049 KRWWNAYMLFYTRCDQTPVQYE--PSVEQLSLAESRNMVLPLPKPIERSVRHQNIRFLHSRSIFS 2111
            |||||||:|||.|.|.|....|  ..:.:|::.....::.|   .|||||..||::|||::..||
  Rat  1942 KRWWNAYILFYERMDITDEDNEMITYLSELTITRPHQIMSP---AIERSVWKQNVQFLHNQMQFS 2003

  Fly  2112 VEFFNFIKKLVSCNLL----SARSNKITPAAEELSLLGVQLASQFLFHTGFRTKKSLRGPVMEWY 2172
            :|:|.|||||::||.:    :...:.:.|.||:::::.:|||::|||.|||.|||.:|||..:||
  Rat  2004 LEYFQFIKKLLTCNAVYLNPAPGQDHLPPEAEDITMISIQLAARFLFTTGFHTKKIVRGPANDWY 2068

  Fly  2173 DALSHHIRSSALVRKWFANHALLSPPSRLGEYILMAPSPDVRTVFVKLVVFFCHFAINDEPLTG- 2236
            |||...:|.|..||.|||::.|.:..:|..||:|..||.:||..|.||:||..||::.|...:. 
  Rat  2069 DALCILLRHSKNVRFWFAHNVLFNVSNRFSEYLLECPSAEVRGTFAKLIVFIAHFSLQDGSSSSF 2133

  Fly  2237 -------------YDGANLCEQVLISVLRLLKSEAADYGKHLPHYFSLFSMYVGLGTREKQQLLR 2288
                         ||..:|.:.:|.:||.||:.|.:::|:||..||:||.||..||..||.|||:
  Rat  2134 ASPFATPGPYSQIYDNLSLSDHLLKAVLSLLRREVSEHGRHLQQYFNLFIMYASLGLAEKTQLLK 2198

  Fly  2289 LNVPLQFIQVALDDGPGPAIKYQYPEFSKLHQVVSHLIRCSDVSEKCQSSNQNARPLSNPFKDPN 2353
            ||||..|:.|:||:||||.|||||.|..|||.|||.||||..||.:.|||.....||.|||.|||
  Rat  2199 LNVPTTFMLVSLDEGPGPPIKYQYAELGKLHSVVSQLIRCCSVSSRMQSSINGNPPLPNPFGDPN 2263

  Fly  2354 VAHEELTPLSTECMDLLFNRTGYIKKVIEDTNVGDEGLKLLQYCSWENPHFSRAVLTELLWQCGF 2418
            :: :.:.|:.....|:||.||.|:||:|||.:..:|.:|||::|.||||.||.:||:|||||..:
  Rat  2264 LS-QPIMPIQQNVADILFMRTTYVKKIIEDCSNSEETVKLLRFCCWENPQFSCSVLSELLWQGAY 2327

  Fly  2419 AYCHDMRHHTDLLLNILLIDDSWQHHRIHNALNGVAEEREGLLETIQRAKTHYQKRAYQIIKCLT 2483
            :|.::::.:.||||.|:|::||||.|||||||.|:..:|:||.:|||..|.|:||||||.||.:.
  Rat  2328 SYAYELQPYLDLLLQIILLEDSWQAHRIHNALKGIPSDRDGLFDTIQHFKNHHQKRAYQCIKWMV 2392

  Fly  2484 QLFHKSPIALQMLHTNSNITRHWSIAVEWLQGELDRQRGIGCQYNSYS-WSPPAQSNDNTNGYML 2547
            .||:..|:|.|:|..|.::.:.|:.|||||..||:|:...|..:.:|| ||||.|||:..|||.|
  Rat  2393 TLFNSCPVAYQILQGNGDLKKKWTWAVEWLGDELERKPYSGNPHYTYSNWSPPIQSNETANGYFL 2457

  Fly  2548 ERSQSAKNTWSMAFELCPDEVSEKTDENNEPNLETNMDENKSEPVAQ 2594
            |||.||:.|.:.|.:|||:   |.||:.:.|      ||::| |..|
  Rat  2458 ERSHSARMTLAKACDLCPE---EDTDDQDAP------DEHES-PAPQ 2494

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fafNP_524612.2 peptidase_C19C 1666..2064 CDD:239124 246/414 (59%)
UCH 1668..2059 CDD:278850 241/407 (59%)
Usp9yNP_001316831.1 peptidase_C19C 1554..1957 CDD:239124 246/414 (59%)
UCH 1556..1952 CDD:278850 241/407 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D22076at33208
OrthoFinder 1 1.000 FOG0001696
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24006
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.120

Return to query results.
Submit another query.