DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: faf and usp24

Sequence 1:NP_524612.2 Gene:faf FlyBaseID:FBgn0005632 Length:2778 Species:Drosophila melanogaster
Sequence 2:XP_002931653.2 Gene:usp24 XenbaseID:XB-GENE-6035156 Length:2577 Species:Xenopus tropicalis

Alignment Length:2785 Identity:776/2786 (28%)
Similarity:1269/2786 (46%) Gaps:517/2786 (19%)


  Fly    52 ANSSLPGGGSGSLDGNQDQQPA----TDSQSSDDVAASLSANSVDSTITIVPPEKLISSFPTTKL 112
            :.||...|..||  |..|..||    .:.:.:|: ..:.|..:::              ||||.|
 Frog    59 SRSSNDSGNRGS--GGFDPPPAYHEVVEPEKNDE-NGNCSGENIE--------------FPTTNL 106

  Fly   113 RSLTQKISNPRWVVPVLPEQELEVLLNAAIELTQAGVDHDCEPCVEFYRNGLSTSFAKILTDEAV 177
            ..|..::....|.:|...|:.|...|.|:..|.:.|:....|.|..|....:..:|.|:||..||
 Frog   107 YELESRVLTDHWSIPYKREESLGKCLIASTYLAKLGISDSDENCKRFMDRCMPEAFKKLLTSSAV 171

  Fly   178 NSWKNNIHHCILVSCGKLLHLIAIHMQRDN--PYLLDLLAIVFDPENKFNTFNAGRQPECFAAPD 240
            :.|...||..|......|:.|:|..::::.  ..||.:|.:.|:|:|:::..|  |...|.....
 Frog   172 HKWGTEIHEGIYNMLMLLVDLVAERIKQETIPTGLLGVLTMAFNPDNEYHFKN--RMKACQKNWS 234

  Fly   241 YIWGQLDSNKMYARPPPE--PKNARGWLVDLINRFGQLGGFDNLLERFNIGLELLKRNQNKCTGK 303
            .::|:   ...||..||.  .|...||||||:||||:||||..:..:.|                
 Frog   235 DVFGE---GNTYAVSPPSSMQKEPHGWLVDLVNRFGELGGFSAIQSKLN---------------- 280

  Fly   304 NISVEGRVENGAQDNRLTLALIHSLLRPFGQCYELLMPATIAKYFMPTWNVVLDLLDSFTDEELK 368
                       ::|  :.|..:.:|::|.|.|.|.|..:|:........:.::..:.|..:::||
 Frog   281 -----------SED--IELGAVSALVQPLGVCAEYLNSSTVQPMLDRVIHKMIKYVQSVEEKDLK 332

  Fly   369 REVKPEGRNDYINGIVKSARLLASRLTGQEELIRDLEMFRLKMILRLLQVSSFNGKMNALNEINK 433
                 :.|...|..::.:.:||..|.  |.:|:..::..||.::||:|:...|:.|||:|.|:.|
 Frog   333 -----DKRLVSIPELLSAIKLLCMRF--QPDLVTAVDDLRLDILLRMLKSPHFSAKMNSLKEVTK 390

  Fly   434 VLSSVAYFSHRSQPLPHCMPEDEMDWLTADRMAQWIKSSDVLGVVLKDSLHQPQYVEKLEKIIRF 498
            ::..    |..|:.:.:.        :..||:..|:..:.||.:.|:.::.|.||.::::.||..
 Frog   391 LIED----STLSKSVKNA--------IDTDRLLDWLVENSVLSIALEGNIDQAQYCDRIKGIIEL 443

  Fly   499 LIKEQALTLDDLDAVWRAQAGKHEAIVKNVHDLLAKLAWDFTPEQLDHLFEAFQASMTTANKRQR 563
            |  ...|:||:|..:|:.|:|:...:::|:|.::|..|..|..:||.|||...|......:.|.|
 Frog   444 L--GSKLSLDELSKIWKIQSGQSSTVIENIHTIIAAAAVKFNSDQLSHLFVLIQKCWENESDRVR 506

  Fly   564 ERLLELIRRLAEDDKNGVMAQKVLKLFWTLAHSQEVPPEVLDQALGAHVKILDYSCS--QERDAQ 626
            ::||.||.|:..:.:|.....|||::.|.|||...:|..::.|||..|:.||   |.  ..::..
 Frog   507 QKLLSLIGRIGREARNETTTAKVLEVLWELAHLPALPSSLIQQALDEHLTIL---CDAYAVKETI 568

  Fly   627 KTIWLDKCVDELKSGDG-------WVLPALRLIRDICCLYDTTTNHAQRTQTSTNRQQVIERLQN 684
            |..::.||::::|....       ||:||||.:.:|...::..|...|       .:.:|:.|:.
 Frog   569 KRSYIIKCIEDIKKSSQHNNPQVVWVVPALRQLHEITRSFNKQTYQKQ-------DKSIIQDLKK 626

  Fly   685 DYSLVILVTNSLTAYMEKVRQMVTDSPGLDATRILIDGRFPHHVQIAERLEFLKFLLKDGQLWLC 749
            ::.:|.|||.||.|........|  .||......|:|||:.:...:...|:||.|.|::..|:|.
 Frog   627 NFEIVKLVTASLVACHRLAVNAV--GPGGLFGSTLVDGRYTYREYLEAHLKFLAFFLQEATLYLG 689

  Fly   750 ADQAKQIWHCLAV-NAVFPADREECFRWFGKLMGEEPDLDPGINKDFFENNILQLDPHLLTESGI 813
            ..:||:||.||.. :.|...|||.||.||.|  |:. ||:..:.:..|:..||:|:.:.:|.:|.
 Frog   690 WSRAKEIWECLVTGHDVCELDREMCFEWFTK--GQH-DLESDVQQQLFKEKILKLESYEITMNGF 751

  Fly   814 KCFERFFKAVNSKEDKLKAIHRGYMLDNEDLIGKDYLWRV-ITTGGEEIASKAIDLLKEVS-TAL 876
            ..|:.||:.||..:.:||......:::..:|||.|::|:: :.:..||||::||.|:...| ..|
 Frog   752 NLFKTFFENVNLCDHRLKRQGTQLLVEKLELIGMDFIWKIAVESPDEEIANEAIQLIINYSYINL 816

  Fly   877 GPRLQENIAEFHEMFIGECCSRLR-----------THYGNIVILGKTQLQEELDAPDQSDNTNDE 930
            .|||:::....|:.||.:|.:||.           ||    .:...|::......|..:.:....
 Frog   817 NPRLKKDSVPLHKKFIADCYTRLEAASSALGGPTLTH----AVTRATKMLTATAMPSVATSVQSP 877

  Fly   931 SKDSKMRFIEAEKMCRILKVLQEYVKECDRSFSGDRVHLPLSRVTRGKNTILYIRFQNPGRSIDD 995
            .:.:|:..||     |:|.:.:.||...:..:|..|..||......|....|.:.:::   :.|.
 Frog   878 YRSTKLVIIE-----RLLLLAERYVITIEDLYSVPRTILPHGASFHGHLLTLNLTYES---TKDT 934

  Fly   996 MEIVTHSNETMAAFKRNLLKRIKGTSTANIKVDLFYANDEMIGVSDEINPLYQYTIRDKMNLTAK 1060
            ..:..|||||:.:.:..:.:.: .....|:::   :||:.::.|:.:...|:|....|:..||.|
 Frog   935 FSLEAHSNETIGSVRWKIARHL-NCPVENVQI---FANESLLTVNKDQKLLHQLGFSDEQALTVK 995

  Fly  1061 LTPVGTGLASSPDSSSDSSTGSPPRPCPDMQRVESESTLPGVIISQNYQYTEFFLKLYQLGSDLE 1125
            ....||...||.|:|..|.|.|  ........::.|.:||||:::   .....|..|||| ::||
 Frog   996 TLGGGTPSGSSTDASCSSGTSS--GVFSSSYAMDQEKSLPGVVMA---LVCNVFDMLYQL-ANLE 1054

  Fly  1126 HGRLRDSAKVLLHLLPCD---RQTIRQLKIMCKVPKAAVTVAVTGDKIAKDEEEKLYPTEQAGIE 1187
            ..|:....:.||.|:|.|   ::.:.||..:             |.|.....|.:...:.::...
 Frog  1055 EPRITVRVRKLLLLIPTDPAVQEALDQLDSL-------------GRKNTLLSETQASQSSKSPSL 1106

  Fly  1188 DEEEHCTP------EQMFLHPTPA----QVLYNLSVLHGLLIPALDPLGESALLVQSA----WMH 1238
            ..::|..|      |.:|....|.    :|||||.||...|:|..|  .|.|.....:    ::.
 Frog  1107 SSKQHHQPSASSILESLFRSSAPGMSTFRVLYNLEVLSSKLMPTAD--DEMARNCAKSFCENFLK 1169

  Fly  1239 SGCAHFVLELLTKNNFLPSADMHTKRASFQCVLRLAKLFLYIVGSVLSRVGDEPMICDLDNGSRS 1303
            :|....|:.::.:::.....|..|::..:...|:||:..|  ||..:....||    ||:...  
 Frog  1170 AGGLSLVVNVMQRDSIPSEVDYETRQGVYSICLQLARFLL--VGQTMPATLDE----DLNKDG-- 1226

  Fly  1304 QVDILKQNFSTMPSSSQGTLRAISAKLAVILAREMLSASPEGDRCRTLFSS-------------- 1354
                 .::.|:.|..:.|  |..|.:::       |..:||....|.|..|              
 Frog  1227 -----IESLSSRPFRNAG--RQSSRQMS-------LCGTPEKSSYRQLSVSDRSSIRVEEIIPAA 1277

  Fly  1355 -----TLQ---WSCPDISTIKAVVQLAWASSCGNLQALGNSSGDFEDEVIVPDG----------- 1400
                 |::   ::|    |:...::|:||::.|.|..:|::....|...:.|.|           
 Frog  1278 RVAIQTMEVNDFTC----TVACFMRLSWAAAAGRLDLVGSNQPIKESNTLFPAGLRSRLSSSGSN 1338

  Fly  1401 -------------------------QDFSMCKEALEVLTISFILNPSANEALTSDPNWPKFITSI 1440
                                     :|..:..|||.:|.....|......:..:.|:...|...|
 Frog  1339 CSSGSEGESTSLHAWICVRQQSVSTKDAIIAGEALSLLVTCLQLRSQQLGSFYNLPSVADFTIDI 1403

  Fly  1441 VLKNPLRHVRQVASEQLFLASTYCAGD----RRPFVYMVNLLVGALKTLVPQYEST--------- 1492
            :|.:|...:|:||.:||:..|......    ::|.::::.:::.|   .:|.:..|         
 Frog  1404 LLGSPSAEIRRVACDQLYTLSQTDTSSYPEVQKPNLFLLTVILSA---QLPLWSPTSIMRGINQR 1465

  Fly  1493 ----CAEFFSVLCRTL-SYGCIYNWPLQISEG-LLGDEIKWLQRIRENVHATGDTQVHEEL-LEG 1550
                |.|:|.:.|:.| ...|.....|.:|.. :|.|||.||.....|..|..:|...:.: |.|
 Frog  1466 LLAQCTEYFDLRCQLLDDLTCSEMEQLNVSPATMLEDEITWLDNFEPNRTAECETSEADNVWLAG 1530

  Fly  1551 HLCLAKELMFFLGADSKAQLNELIHELIDDFLFTASREFLHLRRH---GSL---RQDTVPPPVCR 1609
            ||.|.|.|:...||:.:.....||.:|:|||||.|||  :.|..|   ||.   :||.  .|.|.
 Frog  1531 HLRLIKTLLSLCGAEKEMLGPSLIKQLLDDFLFRASR--IILNSHSPAGSAAISQQDF--HPKCS 1591

  Fly  1610 SPHTIAAACDLLIALCQLCVPNMKLLTNTLIDFVCTDTDP--LREWDYLPPVGARPTKGFCGLKN 1672
            :.::..||.::|:.|.:..:.|::|:|..|:. :....||  .:|:||||||.:|...||.||||
 Frog  1592 TMNSRLAAYEVLVMLAESSLANLQLITKELLS-MHHQPDPAVTKEFDYLPPVDSRSNSGFVGLKN 1655

  Fly  1673 AGATCYMNSVLQQLYMVPAVRVGILRAHGAATTDGEDFSGDSDLTGGGLGSALFSGPASALVSLP 1737
            .|||||||:|.|||||.|.:...:|...|  .||..|.|                          
 Frog  1656 GGATCYMNAVFQQLYMQPGLPEALLSMEG--DTDNPDES-------------------------- 1692

  Fly  1738 SSSSTIEDGLHDVRKNYHVVILKHVQAIFAHLGHSALQYYVPRGLWTHFKLLGEPVNLREQQDAV 1802
                                :...||::|.||..|.||||:|...|..||:..:.:.:||||||.
 Frog  1693 --------------------VFYQVQSLFGHLMESKLQYYIPENFWKIFKMWNKELYVREQQDAY 1737

  Fly  1803 EFFMSLLESLDEGLKALGQPQLMNATLGGSFSDQKICQECPHRYSKEEPFSVFSVDIRNHSSLTE 1867
            |||.||::.:||.||.:|:.|:...|..|.:||||||::|||||.:||.|...::.:.:..||..
 Frog  1738 EFFTSLIDQMDEYLKKMGREQIFKNTFQGIYSDQKICKDCPHRYEREEAFMALNLGVTSCQSLEI 1802

  Fly  1868 SLEQYVKGELLEGADAYHCDKCDKKVVTVKRVCVKKLPPVLAIQLKRFEYDYERVCAIKFNDYFE 1932
            ||:|:|:||:|||::||:|:||..|..||||.|:|.||.||.|.|.||.:|:|...:||:::..:
 Frog  1803 SLDQFVRGEILEGSNAYYCEKCKDKRTTVKRTCIKSLPSVLVIHLMRFGFDWESGRSIKYDEQIK 1867

  Fly  1933 FPRILDMEPYTVSGLAKLEGEVVEVGDNCQTNVE------------TTKYELTGIVVHSGQASGG 1985
            ||.:|:||||||:|:|:.:.. .|.|:|.: :::            |..|||.|::||||||..|
 Frog  1868 FPWMLNMEPYTVAGMARQDSS-CEAGENGR-HIDPGGGSPRKKVAPTENYELVGVIVHSGQAHAG 1930

  Fly  1986 HYFSYILSKNPANGKCQWYKFDDGEVTECKMHEDEEMKAECFGGEYMGETYDNNLKRMQYRRQKR 2050
            ||:|:|..:. .:||.:||||:|..|.|..:: ||.::.|||||||..:.||.:......||  |
 Frog  1931 HYYSFIKDRR-GSGKGKWYKFNDTVVEEFDLN-DETIEYECFGGEYRPKVYDQSNPYPDVRR--R 1991

  Fly  2051 WWNAYMLFYTR-CDQ-TPVQYEPS--------VEQLSLA-------------------------- 2079
            :||||||||.| .|| :||..:.|        .|.|||:                          
 Frog  1992 YWNAYMLFYQRVSDQNSPVLPKKSRVSVVRQEAEDLSLSAPSSPDISPQSSPRPHRPNDRLSILT 2056

  Fly  2080 ------ESRNM-VLPLPKPIERSVRHQNIRFLHSRSIFSVEFFNFIKKLVSCNLLSARSNKITPA 2137
                  |.:.: |..:|..|.::||.:|::|:.:|.:::.::|:|:..|.|.|....:.    |.
 Frog  2057 KLVRKGEKKGLFVEKIPLRIYQTVRDENLKFMKNRDVYNSDYFSFVLSLASVNATKLKH----PL 2117

  Fly  2138 AEELSLLGVQLASQFLFHTGFRTKKSLRGPVMEWYDALSHHIRSSALVRKWFANHALLSPPSRLG 2202
            .:.::.:..|||.||||||..|||:.||....||...:...:..|....:|...:.:.|....|.
 Frog  2118 YQPMAKVSAQLAIQFLFHTYLRTKRKLRVDTEEWIATIDALVSKSCEACQWLMEYFVCSEGKELV 2182

  Fly  2203 EYILMAPS-----PDVRTVFVKLVVFFCHFAINDEPLTGYDGANLCEQVLISVLRLLKSEAADYG 2262
            :..|:..|     ..|.|:..|.:         |..|...|..|....::..:|.||:.:..:..
 Frog  2183 KIFLLESSIREVRAAVATILEKTL---------DAALFHGDKVNGVHLLIEMLLSLLEKDVPESC 2238

  Fly  2263 KHLPHYFSLFSMYV-GLGTREKQQLLRLNVPLQFIQVALDDGP-----------GPAIKYQYPEF 2315
            |:...||.|||.:| ..|:|....|||.:....||...|  ||           .|    |..||
 Frog  2239 KNCAQYFYLFSNFVQKQGSRAVDLLLRYSALKHFINFLL--GPNRQNNQNRRWSSP----QAREF 2297

  Fly  2316 SKLHQVVSHLIRCSDVSEKCQSSNQNA-------RPLSNPFKDPNVAHEEL---------TPLST 2364
            ..||..::.|:..|||     ||::..       .|.:|....|.:.|.|:         .|...
 Frog  2298 GYLHSTIALLVLYSDV-----SSHRTVAPGVFKPHPSTNTCGSPLLLHAEVEALMFMPEGKPYLL 2357

  Fly  2365 ECMDLLFNRTGYIKKVIEDTNVGDEGLKLLQYCSWENPHFSRAVLTELLWQCGFAYCHDMRHHTD 2429
            |.|..|....|.:..:||          ::.||.:.|..||..:|..:..|...|..|::::...
 Frog  2358 EVMFALRELPGSLTVLIE----------MVVYCCFCNERFSLTLLHFIKNQLETAPPHELKNVFT 2412

  Fly  2430 LLLNILLIDDSWQHHRIHNALNGVAEEREGLLETIQRAKTHYQKRAYQIIKCLTQLFHKSPIALQ 2494
            ||..||:|:|..|..|:....     |.:|||..:..:......|.||.:|.|..|..|.|.|.:
 Frog  2413 LLYEILVIEDPLQLQRLKFTF-----ESDGLLALMHHSNHVDSSRCYQCVKFLVTLAQKCPAAKE 2472

  Fly  2495 MLHTNSNITRHWSIAVEWLQGELDRQRGIGCQYNSYSWSPPAQ-SNDNTNGYMLERSQSAKNTWS 2558
            ....||:   |||.||:|||.::          :.:.|:|.:. ||:.:.....:|:.||::|.:
 Frog  2473 YFKDNSH---HWSWAVQWLQKKM----------SEHCWAPQSNISNETSTAKTFQRTVSAQDTLA 2524

  Fly  2559 MAFELCPDEVSEKTDENNEPNLETNMDENKSEPVAQPGGVLEGSTGGTEQLPENK 2613
            .|..|    ::||             |::             ||:.|:|..|.|:
 Frog  2525 YATAL----LNEK-------------DQS-------------GSSNGSESSPANE 2549

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fafNP_524612.2 peptidase_C19C 1666..2064 CDD:239124 171/411 (42%)
UCH 1668..2059 CDD:278850 166/403 (41%)
usp24XP_002931653.2 UBA_UBP24 6..42 CDD:270472
peptidase_C19C 1649..2005 CDD:239124 170/410 (41%)
UCH 1651..2000 CDD:278850 166/403 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5077
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D22076at33208
OrthoFinder 1 1.000 FOG0001696
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.