DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rod and kntc1

DIOPT Version :8

Sequence 1:NP_476705.1 Gene:rod / 43719 FlyBaseID:FBgn0003268 Length:2089 Species:Drosophila melanogaster
Sequence 2:XP_009300257.2 Gene:kntc1 / 497376 ZFINID:ZDB-GENE-050208-92 Length:2241 Species:Danio rerio

Alignment Length:2393 Identity:482/2394 (20%)
Similarity:901/2394 (38%) Gaps:570/2394 (24%)


  Fly     1 MWSNFEA------------SSLEDETISNIFSSRGIFQISSEEEVNKYPDVMASVQCGKMVIGID 53
            ||:|.|.            :.:|.|:.:.::....:.:|||.|:|...|:|.||......:|.:|
Zfish    10 MWNNVELLLNEDTNTVRLYNDVEQESGNALYQVDNLVKISSSEKVVSKPNVYASSTPNCCIIVVD 74

  Fly    54 KSLLLLEDELVAKCSFLAFGAAIEAIAISSSGNLIVCGLSDGEVHGVFIKGLLLFSVAVNLEDVS 118
            .:::|.:.........|.|.:.::|:.:...|..::.|..:|.:|.::|. |....:..||....
Zfish    75 TAVVLFDPGFQTVLIHLYFDSVVDAVTVCPQGQFLLVGERNGSLHIIYIP-LKKTVLTKNLPQQK 138

  Fly   119 LTGG--TFRS--IHQL-----DQRFYFTCKNGSIYSLSDIDETCLETLGNMSLN------ENETI 168
            .:.|  ||:|  :|:.     |...:|..|:|.::            :.|::|.      ||..:
Zfish   139 SSCGETTFKSLILHEKPGSKGDYDLFFVIKDGFLH------------VSNVALGKIQRAIENMDL 191

  Fly   169 ACEKALLEDVTIQRLS------KGRSSCSVDCAVLLKRLLTGNISAENNQDDLEAQPGLVITGDQ 227
            .....:.||:.:...|      .|..|.|:.|......||.|            |....|::  .
Zfish   192 VVLNKIQEDILMNFFSTKEIHEDGCISASLVCFGSTSHLLIG------------ADGANVLS--L 242

  Fly   228 STMNFRNAANDVTRINLPAQYGSLKQIFNLEHYIIALTDSGHLVEICPYTRTVYMCQTTQQKNLL 292
            .:|.....:..:|::...:....:|::..:::.:..|.:.|.|..:..::..:..|...|   .:
Zfish   243 WSMGLHQTSMSLTKLLDSSLMSEVKKVQVVDNLMYVLNNEGMLSMLDIHSFVMLCCWPDQ---YI 304

  Fly   293 IEDLLVMECS-------EDN---IELLVLTKSTAEGRFIKIVEYPTLNVKNEVEVPDHAWLVRQP 347
            ::.||:.:.:       :||   |..||:..:....|.:.:....::.|...:||...:||:::.
Zfish   305 VDFLLISDGNSSSITQQDDNTLKIMTLVVEGNKDHSRKLVVQSLSSMEVFYSLEVSSESWLIQKG 369

  Fly   348 KCAVNLYYLAAKEVNQSSIP----SVVEMMLVSETDPSDRFKKLICKGRLEEAEEFGKQFELCLQ 408
            .....:|.|.....|..|.|    |.|.:...:|..|.:|..||:.|.:.||||:|.|.|.|.::
Zfish   370 ISMDTIYLLEGVLANTKSSPEDPVSTVVIRCFTEALPENRLNKLLYKHKFEEAEKFAKTFGLDVE 434

  Fly   409 PIYEAKAKRILVELCNSNSQNVDTKFQDLLQLLSQVESKAFIKSHRMINLNSRHILERY------ 467
            .:|:.|...:|.:|.:::..:...::.:|:|     |:|.     .::.:.....:.:|      
Zfish   435 LVYKVKLNVVLEKLISASGNDQTIEWPELIQ-----EAKT-----NLMKIMDEQFVVQYCLSASW 489

  Fly   468 --LHEVKKRLTFEDDEEDMLEIDEQLHRLKTLAIIDPYECNT----DWQKFIYDNNLVRMVKSLF 526
              |...::.|.:..:.....:|...|.:|.|.:.:  |..|.    .|.:|:...:.::.:.:|.
Zfish   490 PTLSIAEEMLNYTLNRFPCCQIQTALAKLATFSSM--YGPNNFDGIKWIEFLNSTDYLKDILALL 552

  Fly   527 NT-DMPTACLIWRRHSSSILPLLNEDELRTLLGFIPSNTKPFNVVQWLR-QFIPMVSNTHPSIMP 589
            .. ::..|..:|.||........:|.....||..|.|:....:::.|.: ..:|.|....|....
Zfish   553 KEGNVNGAQYLWLRHEGEFASEFDEACFHALLSSISSDIPSQDLIPWFKGVVVPFVWRVLPKGQK 617

  Fly   590 FITDWSIEMTRNLQYS--PHWPDIGL-----------------EFCTKILDIFEEIQFTYSDVRR 635
            .|..|.....|||:.:  ..||..||                 |.|..     ||::        
Zfish   618 IIARWLEHRARNLELTEKSDWPQNGLLLAELGLPSLWRSMGLAEICGA-----EEVE-------- 669

  Fly   636 QQERNVGKLRDLVNALQDLSVLKTNYNMGFTLDNYMQDSIDATALSILQHVQLDKL-QRLVKNFM 699
                   .||.||..|:.|..|...||...:|.:|.:.|..:.|..:|..||..:| ..:|::.:
Zfish   670 -------SLRSLVANLRQLCDLYIKYNCHLSLSDYERGSTRSMAFLMLDKVQAPELIPAVVESSV 727

  Fly   700 YPIFQEKGRQPLDVIKQYISQLV---ASRLSS--SSWLDRAMACIELLHNEDSRLECALSVLQNA 759
            .|...|.|......:..||..|:   :|:::|  :.|..:|:|.:..:.:.:..::..:.::..|
Zfish   728 EPYALENGLDLDQTLLDYIKDLLDCCSSQITSLFTEWEAKAVAVLHCMKDTNKVMDAVIEIMYKA 792

  Fly   760 PVPWPDTLAPLIRLR-ASTHPLAVKINAEYEIQVIKIMKVKYGWP--ADSSDINLELFMMRIVKL 821
            .|||.||:..|::|. ...||....:...|.:..||.:...||..  |.|:..::.:.:..|:|.
Zfish   793 VVPWSDTIEKLVQLHLEKEHPKQELLREGYRLMEIKKLLRCYGIRSLALSNSRDIMMLVRYILKQ 857

  Fly   822 NLPDMLDDISALTKAAPELSTSANFNCCYQMARRGQVEMAYEFFKKLN----------------- 869
            :||..|:|...|.:|........:...|.|:.:|.:.|......|.|.                 
Zfish   858 DLPTSLEDSLKLIEAYKLNPAEFHHLHCIQLIQRNKREKCTTLLKSLPHSEAIFVIERMACWARL 922

  Fly   870 --------GEKNSKSAKEVVEIMANILENSSSASFESDIKVQEHLNVLELFKLFLPHVESVYE-- 924
                    .|:..|....:.:||...|:...|...:...|..|..|.|::|.. :.|::..::  
Zfish   923 ELQDKQHISEEQKKLQMLISQIMVEALKYLQSIQTDDAFKKTECENNLKMFTA-IAHLQEDFDIF 986

  Fly   925 ---RRY--LVIKHRFRLRKFGILLSCSSELIPLHRRHCLLDEAIERIIER-----AQATLNVSAF 979
               ..|  .|::|:|           :.:||..:..    .:|..|..::     :.:.||.||.
Zfish   987 LTPEEYDDPVVRHKF-----------NQQLITAYEN----TQAWRRSGKQHPDKVSDSNLNGSAA 1036

  Fly   980 IASEISELCTALGLPKVFGLHRICQRIGCL--PLSCALAYHVVSFVDCVPANAGEFVNLALELLV 1042
            :|::......:|....  ||||:.:::...  .|...||...:        :||. |..||::|.
Zfish  1037 VANDPDGKTKSLSTEA--GLHRLARQLQKTEQELWADLALRAL--------DAGN-VEKALQILS 1090

  Fly  1043 QQIESAKGKNQ-----ETASSL-QLINENDPLSFYLAYELLTSALLH----------ESSRRHDL 1091
            :..:.....:.     .||..| |::.||.|:  .|..:....|::|          .|....|.
Zfish  1091 ELYQHHSNCSTGRVLFSTAQRLCQMLEENVPM--VLPEKTNLPAVIHRLACQAITVCHSDLLLDC 1153

  Fly  1092 VELIKYIRVA--------VIHYPLDAIKSHYDGKEQAVNE---HICRALDGISVALGETTINFSC 1145
            :||.|..|.|        :..:...|.:|...|:|.|..|   |.....|||             
Zfish  1154 LELCKSTRTAADVYRQCQIEDFGFFAKESSMSGEEDAYAESHFHDVFNEDGI------------- 1205

  Fly  1146 ALNGSFDVKTLTVPTTTKKRYSVSMFDEVEVQPIQQQPQKKSVGGRMAIVKFLARTLL------- 1203
                                    :.|.|.|.|:|.:               :.|.||       
Zfish  1206 ------------------------VLDPVSVLPLQYK---------------ITRNLLPLSESRL 1231

  Fly  1204 -------LMVIETEPNNSLLMQVRNELPENTKADVESACADFFLSLEHLTKVKEHDAWYVMSQY- 1260
                   |....|:.:..|:..:.|  |..:...:...|:...|::..|           |..| 
Zfish  1232 FPFDCSCLSYCSTKEDAELVGPLLN--PMASMLQMLQECSQLELAVRLL-----------MESYG 1283

  Fly  1261 --LLDFQKQN---CRTKRIINEGFITLQ---LRRIFRNAMGSKDVNFIELFTML----VVDSE-A 1312
              ||.|...|   ..:||:.:...:...   |.:|.:..:.|..|..:.|...:    ||||: |
Zfish  1284 SILLHFVSNNMDISLSKRLQSNNRMARDKQTLDKIEKTVLSSVSVVVVSLLQKVLNWRVVDSDLA 1348

  Fly  1313 LALLEKLSVEVKTDL---------QKINFLTLSAMYHEHIEDLDSVHMIRTKRLKLFYYLEFCQQ 1368
            :.|...||.....|:         |..:.:.:.||...|:                    .|..:
Zfish  1349 IGLCTILSKAAVIDILWKIINSAWQNYDKIKVVAMVGAHV--------------------SFLYK 1393

  Fly  1369 DHRIKGKFNADMDNIE----------------------------DLLKEFHNKQLDVQLLERMSK 1405
            |...:|||.:.:.:.|                            .|:|   ||.:...::.....
Zfish  1394 DEEERGKFVSVITDAEWGVQLGRLGVSIQSVFRQCTETKRNLIPTLVK---NKNITPDIILHYCS 1455

  Fly  1406 DFGFDYQKILITQILSILSAQELRFEVKRDTFGDEELVM-----LSSAQEMRDMCQPYINEINNV 1465
            .||.|....:...|.::|..::..:|::.:. ||.|..:     |....:|.:.....|.::.:.
Zfish  1456 TFGLDSYSAINLYITTLLLQEDRWYEMEIEE-GDAESSLRIQESLRGKDDMLESALQIIPQLGST 1519

  Fly  1466 ELFTSKLKHFIEDINIYFYELYMCVINILMYFDSAPKEMEIWMNILHFLRHKMITRRRNRPGQVE 1530
            :.....|...:..:|.|.||....|:..:...|.:...:.:. .::..|:|....||.:.|..:|
Zfish  1520 KDLVISLNTALTKLNPYNYEWIERVLKTIQMADESTTLIPLG-QMVGLLQHLKSHRRISPPTDLE 1583

  Fly  1531 TDTWLKSQRENGVMP-KISRYRLPF---------------KPIVEQPLKDIL----DSELNVDNC 1575
            :...|    ||.:.| .::..||||               ..:.|:.|..:|    ..::|:|..
Zfish  1584 SSYLL----ENSLEPTALANTRLPFHLLFQSSHAFWKIVSPELSEETLPTLLLICKLMKVNLDKL 1644

  Fly  1576 ----------QSWFPLIQMYTA----LKGSKDSSQNCDYFCMSA--VKN----SISEYKSKNDSE 1620
                      :|..||:...|.    |..||:.....|.....|  ::|    :.:.:|...|..
Zfish  1645 YVLAVNHVFKKSLLPLLMDQTKKIQHLGSSKELCSVTDSVFQHALCIQNLELAAATVHKIAQDLP 1709

  Fly  1621 SWSLHPTNNAFLQSILRLVEKVNNPNKAFLILYFVSNYARDGADQVEASYECWKFVKEKGHLITD 1685
            :.::   ...||:..|.||.|:..                  :|.:|.|      ::.:|..:  
Zfish  1710 AGAV---KTDFLKFSLDLVHKLLK------------------SDTLEES------LQARGEAL-- 1745

  Fly  1686 PKSREQVAKVKRRYPIQKTQHLLYVYGLTDEKLLRQVENPTELIQALYHHELILKSSK------- 1743
                  ::|::.:|....|::.|....|...:||:....|..||.||:.|..:|...|       
Zfish  1746 ------ISKLQLQYQRSATENALLSSQLGSPELLKLTGLPGRLIVALFEHSSVLDRMKNPAGQTY 1804

  Fly  1744 VDINALVAEIAKLHDLCLATIQYRLLQKWLALTMESAGDGTILEETFMEEQNWPEQANGAESSNS 1808
            .||:::.:|||.::.:.|..|:..||:|||..|.:|.|                      :..|.
Zfish  1805 PDIHSVASEIASINSVDLLKIRNILLEKWLCQTGQSNG----------------------KDINH 1847

  Fly  1809 QDASENVN------RAFYILSSWPKAEAVKFLVGLIFK-----GGS---VNTSTQLQMYECYSKL 1859
            ||...:||      |..|:|...|...:.:.|..::..     |||   :....:.:...|.:.|
Zfish  1848 QDNVTDVNDDPDLMRVVYLLQMHPMDISARLLSPVLTSQTWPLGGSGLRLTFEHRSRALLCLTHL 1912

  Fly  1860 NDGS--NSFTNTISQRQFISIKC---VHELKALGYKSNLEKFSDDHCNKIDILKMIWQRNAQNPL 1919
            .|.:  .:.:|..|.:....:||   :.:::||.....|:.|...  .|..::|.:|:.:...|.
Zfish  1913 TDAATLETLSNQPSSKIKYYLKCYMYLAQMEALNIPYTLDMFISS--PKEGMIKGLWKNHNNEPQ 1975

  Fly  1920 SLEVMANICLGFDIHLPQIWNGILKRMVMFHMVRELNALLDVLSCRPHLLHLDGLAQAWDYVLCH 1984
            ::.::|::||.:.::..|:||.:|::::.|:|...|..:|:.|...|.||....|::.|..|:..
Zfish  1976 AVRLVADLCLEYGVYDLQLWNSVLQKLISFNMTSYLQKVLEALIAVPSLLEGQSLSRIWRSVIQA 2040

  Fly  1985 PLQNAVELRSFKQEEVLHKTLLRLQGCPVVHALNLL----QFAQL--------------CIVVHR 2031
            |...|....|.:|..|::||.:.|..||.:..|:|:    :|:|.              |:....
Zfish  2041 PFLTASLPLSPQQHMVMYKTFVLLLKCPFLFTLDLVAIAKRFSQFSLQAFSLGTLLLIPCLKKKE 2105

  Fly  2032 PHMAASLLSFC-------QSSEQR---------QKIKKMIHSHPVENLRQQIL 2068
            |.:.:.||| |       |:.|..         .:|::.:.:...:|.:.|.|
Zfish  2106 PQIQSFLLS-CNPTLILDQTEESMATGELAGIPSQIRETVFAFLCQNGKSQTL 2157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rodNP_476705.1 Rod_C 1544..2082 CDD:287465 134/626 (21%)
kntc1XP_009300257.2 Rod_C 1597..2144 CDD:313674 130/607 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C355119759
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D122381at2759
OrthoFinder 1 1.000 FOG0004865
OrthoInspector 1 1.000 T1052990
orthoMCL 1 0.900 OOG5_135652
Panther 1 1.100 LDO PTHR15688
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.950

Return to query results.
Submit another query.