DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Loxl1 and MARCO

DIOPT Version :10

Sequence 1:NP_524607.1 Gene:Loxl1 / 43712 FlyBaseID:FBgn0039848 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_006761.1 Gene:MARCO / 8685 HGNCID:6895 Length:520 Species:Homo sapiens


Alignment Length:76 Identity:28/76 - (36%)
Similarity:34/76 - (44%) Gaps:6/76 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GRVEVSFDFGASWGTICSTSWSMREANVVCRQLGLGYASKASQGTEHGDSRKYPWGMVGTLCRGT 115
            ||.||.  :..:|||||...|...:|.|.||.||.   ||.....:.|......| :....||||
Human   433 GRAEVY--YSGTWGTICDDEWQNSDAIVFCRMLGY---SKGRALYKVGAGTGQIW-LDNVQCRGT 491

  Fly   116 ERRLADCIRES 126
            |..|..|.:.|
Human   492 ESTLWSCTKNS 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Loxl1NP_524607.1 SR 50..136 CDD:214555 28/76 (37%)
Lysyl_oxidase 149..351 CDD:460102
MARCONP_006761.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 142..423
gly_rich_SclB <147..>396 CDD:468478
SR 424..519 CDD:214555 28/76 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.