DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chp and LRRC4C

DIOPT Version :10

Sequence 1:NP_001263137.1 Gene:chp / 43690 FlyBaseID:FBgn0267435 Length:1338 Species:Drosophila melanogaster
Sequence 2:NP_065980.1 Gene:LRRC4C / 57689 HGNCID:29317 Length:640 Species:Homo sapiens


Alignment Length:733 Identity:149/733 - (20%)
Similarity:253/733 - (34%) Gaps:260/733 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   478 LDFSENGISSIENDAFHEIGHSLISLKMSHGYSGSALPAEPLRHLTSLQELDFSNNHISSMSDTS 542
            |:..||.|..|:.::|                          :||..|:.|..|.|||.::...:
Human    81 LNLHENQIQIIKVNSF--------------------------KHLRHLEILQLSRNHIRTIEIGA 119

  Fly   543 FHFLKNLRLLELHDNRIEQVLKGTFQGDIH-SKLEEISLRFNHLTSISQHTFFDLEALRKLHLDD 606
            |:.|.||..|||.|||:..:..|.|   :: |||:|:.||.|.:.||..:.|..:.:||:|.|.:
Human   120 FNGLANLNTLELFDNRLTTIPNGAF---VYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGE 181

  Fly   607 -NKIDKIERRAFMNLDELEYLSLRGNKINNLADESFQNLPKLEILDMAFNQLPNFNFDYFDQVGT 670
             .::..|...||..|..|.||        |||..:.:.:|.|..|                    
Human   182 LKRLSYISEGAFEGLSNLRYL--------NLAMCNLREIPNLTPL-------------------- 218

  Fly   671 LSNLNVNVSHNQIRQLMYNSSWSGRNEHGGMYHSNIKI--LDLSHNNISIIHPGYFRPAEISLTH 733
                                               ||:  ||||.|::|.|.||.|:        
Human   219 -----------------------------------IKLDELDLSGNHLSAIRPGSFQ-------- 240

  Fly   734 LHLGYNSLMNTTRDVFGNMPHLQWLDLSYNWIHELDFDAFKNTKQLQLVFFGHNYLSDIPQDIFK 798
                             .:.|||.|.:..:.|..::.:||.|.:.|..:...||.|:.:|.|:|.
Human   241 -----------------GLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFT 288

  Fly   799 PVQGLRIVDFSHNHLR--------------------------GLPDNL--FYNGGMEK------- 828
            |:..|..:...||...                          ..|.||  .|.|.:::       
Human   289 PLHHLERIHLHHNPWNCNCDILWLSWWIKDMAPSNTACCARCNTPPNLKGRYIGELDQNYFTCYA 353

  Fly   829 ---------LDVSHNMMLKI---PSSSLSSLAALTLCELHLSNNFISTIHSMDLSNKFRSLRYLD 881
                     |:|:..|..::   .|:||:|::.:|      .|..:.| |.   :.|.|.....|
Human   354 PVIVEPPADLNVTEGMAAELKCRASTSLTSVSWIT------PNGTVMT-HG---AYKVRIAVLSD 408

  Fly   882 ISYNYL-LRIDDAVFATMPKLAVLDLSHNRDLKVMDKSFMGLENSLIKLGLENISLSTVPEIRLK 945
            .:.|:. :.:.|....|                .|..:.:|  |:.....|...:.:|.|   ..
Human   409 GTLNFTNVTVQDTGMYT----------------CMVSNSVG--NTTASATLNVTAATTTP---FS 452

  Fly   946 YLREFRLGYNELPSIPQELA----HNMSNLRMLDLSNNDLTN--VPLMTQALPHLRRLMLSGNPI 1004
            |.....:...| ||  |:.|    :|:....::|....::|.  .|..|::......:     |:
Human   453 YFSTVTVETME-PS--QDEARTTDNNVGPTPVVDWETTNVTTSLTPQSTRSTEKTFTI-----PV 509

  Fly  1005 TSLNNNSFDGVNEDLEMLDISNFRLHYFEYGCLDSLPHLRSLKLTAYSHL--EHFNIPHLLRHHY 1067
            |.: |:...|::|.::...|.        .||..::..:.::.|..:..:  :|    |...|| 
Human   510 TDI-NSGIPGIDEVMKTTKII--------IGCFVAITLMAAVMLVIFYKMRKQH----HRQNHH- 560

  Fly  1068 NIRQLWIEAPQPFTRIVKKGSGPTQEMQTLQLGNPTDLQREMEGHLPSKLTNITFSGPQFTNLNE 1132
                                 .||:.::.:.:.:.......||.|||       ....:..:||.
Human   561 ---------------------APTRTVEIINVDDEITGDTPMESHLP-------MPAIEHEHLNH 597

  Fly  1133 RILRGMRSPYLYMQLFNT 1150
              ....:||:.:....||
Human   598 --YNSYKSPFNHTTTVNT 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chpNP_001263137.1 LRR <84..320 CDD:443914
leucine-rich repeat 84..103 CDD:275380
leucine-rich repeat 104..128 CDD:275380
leucine-rich repeat 129..152 CDD:275380
leucine-rich repeat 153..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
leucine-rich repeat 202..226 CDD:275380
leucine-rich repeat 227..250 CDD:275380
leucine-rich repeat 251..279 CDD:275380
leucine-rich repeat 280..326 CDD:275380
leucine-rich repeat 327..348 CDD:275380
leucine-rich repeat 352..375 CDD:275380
PPP1R42 355..564 CDD:455733 24/85 (28%)
leucine-rich repeat 376..401 CDD:275380
leucine-rich repeat 426..450 CDD:275378
leucine-rich repeat 451..474 CDD:275380
LRR_8 473..559 CDD:404697 23/80 (29%)
leucine-rich repeat 475..524 CDD:275380 8/45 (18%)
leucine-rich repeat 500..519 CDD:275380 0/18 (0%)
leucine-rich repeat 525..548 CDD:275380 8/22 (36%)
LRR <540..>834 CDD:443914 77/341 (23%)
leucine-rich repeat 549..574 CDD:275380 9/25 (36%)
leucine-rich repeat 575..598 CDD:275380 8/22 (36%)
leucine-rich repeat 599..622 CDD:275380 8/23 (35%)
leucine-rich repeat 623..646 CDD:275380 6/22 (27%)
leucine-rich repeat 647..730 CDD:275380 14/84 (17%)
leucine-rich repeat 648..673 CDD:275380 1/24 (4%)
leucine-rich repeat 674..705 CDD:275380 0/30 (0%)
LRR <730..1081 CDD:443914 71/406 (17%)
leucine-rich repeat 731..754 CDD:275380 0/22 (0%)
leucine-rich repeat 755..778 CDD:275380 7/22 (32%)
leucine-rich repeat 779..802 CDD:275380 8/22 (36%)
leucine-rich repeat 803..823 CDD:275380 6/47 (13%)
leucine-rich repeat 852..876 CDD:275380 4/23 (17%)
leucine-rich repeat 877..900 CDD:275380 4/23 (17%)
leucine-rich repeat 901..925 CDD:275380 2/23 (9%)
leucine-rich repeat 926..946 CDD:275380 3/19 (16%)
leucine-rich repeat 947..970 CDD:275380 6/26 (23%)
leucine-rich repeat 971..993 CDD:275380 4/23 (17%)
leucine-rich repeat 994..1014 CDD:275380 3/19 (16%)
leucine-rich repeat 1019..1042 CDD:275380 3/22 (14%)
LRRC4CNP_065980.1 LRRNT 47..80 CDD:214470
LRR <76..325 CDD:443914 84/360 (23%)
LRR 1 77..98 6/42 (14%)
leucine-rich repeat 78..101 CDD:275380 8/45 (18%)
LRR 2 101..122 7/20 (35%)
leucine-rich repeat 102..125 CDD:275380 8/22 (36%)
LRR 3 125..146 10/23 (43%)
leucine-rich repeat 126..149 CDD:275380 9/25 (36%)
LRR 4 149..170 9/20 (45%)
leucine-rich repeat 150..173 CDD:275380 8/22 (36%)
LRR 5 173..195 7/21 (33%)
leucine-rich repeat 174..198 CDD:275380 8/23 (35%)
LRR 6 198..219 9/83 (11%)
leucine-rich repeat 199..220 CDD:275380 9/83 (11%)
LRR 7 220..241 11/45 (24%)
leucine-rich repeat 221..244 CDD:275380 10/47 (21%)
LRR 8 244..265 7/20 (35%)
leucine-rich repeat 245..268 CDD:275380 7/22 (32%)
LRR 9 268..289 7/20 (35%)
leucine-rich repeat 269..290 CDD:275380 7/20 (35%)
IG_like 360..443 CDD:214653 21/110 (19%)
Ig strand B 371..375 CDD:409353 0/3 (0%)
Ig strand C 383..387 CDD:409353 1/3 (33%)
Ig strand E 409..413 CDD:409353 0/3 (0%)
Ig strand F 423..428 CDD:409353 1/20 (5%)
Ig strand G 436..439 CDD:409353 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 463..483 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.