DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chp and CG5810

DIOPT Version :10

Sequence 1:NP_001263137.1 Gene:chp / 43690 FlyBaseID:FBgn0267435 Length:1338 Species:Drosophila melanogaster
Sequence 2:NP_650952.2 Gene:CG5810 / 42513 FlyBaseID:FBgn0038866 Length:428 Species:Drosophila melanogaster


Alignment Length:473 Identity:108/473 - (22%)
Similarity:172/473 - (36%) Gaps:168/473 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   706 IKILDLSHNN-ISIIHP-----GYFRPAEISLTHLH------LGYNSLMNTTRDVFGNMPHL--- 755
            |..||...|. .::.:|     .||  :|....||.      |..:.|.|..|.:|.|:|.|   
  Fly    30 IDSLDCRENTCTNLKYPSASAVAYF--SENVTKHLRKYETLVLHSSDLANLPRKIFLNLPQLVEF 92

  Fly   756 QWLDLSYNWIHELDFDAFKNTK---------------------QLQLVFFGHNYLSDIPQDIFKP 799
            ..|:.....|..:.||..||.|                     ||:.:....|.|.|:|..||:|
  Fly    93 HVLECELQQIESVCFDGAKNLKRLNFGGNALRVLDSNTFELATQLEELNLSDNQLEDLPTTIFRP 157

  Fly   800 VQGLRIVDFSHNHLRGLPDNLFYN-GGMEKLDVSHNMMLKIPS-------SSLSSLAALTLCELH 856
            ::.|:.::.|:|.|..|..::|.. |.::.::|..|.::::|.       ..||..:|       
  Fly   158 LKNLQKINLSNNRLITLSQHIFSQLGSLKSINVDSNQLVELPGELFRDQRKHLSEFSA------- 215

  Fly   857 LSNNFISTIHSMDLSNKFRSLRYLDISYNYLLRIDDAVFATMPKLAVLDLS--------HNRDLK 913
            .||..:....     |.||.:.:|.:|:|             |:|..|.||        .|.||:
  Fly   216 QSNQLVRIPF-----NIFREIDHLSLSFN-------------PQLRRLHLSAKINELEATNCDLE 262

  Fly   914 VMDKSFMGLENSLIKLGLENISLSTVPEIRLKYLREFRLGYNELPSIPQELAH------NMSNL- 971
            .::     |:..:|     .:.|...|:     |.|.::      |.||:|.|      |:..| 
  Fly   263 SVE-----LDGRVI-----GVQLEANPK-----LHELKI------SQPQDLEHLYLANTNLYRLD 306

  Fly   972 ------RMLDLSNNDLTN---VPLMTQALPHLRRLMLSGNPITSLNNNSFDGVNEDLEMLDISNF 1027
                  :::||...|:.|   :|.:|.| ..|.||..:.:.:||.:                   
  Fly   307 FLSKASKLVDLDVTDIVNLADLPKITSA-KGLERLSFTYDNLTSNH------------------- 351

  Fly  1028 RLHYFEYGCLDSLPHLRSLKLTAYSHL-----------EHFNIPHLLRHHYNIRQL-----WIEA 1076
                     :|.||||:.|.....||.           |.|.:...   ..|..||     ::|.
  Fly   352 ---------MDMLPHLKDLNYLEISHEKGKEIFIKDLDEDFFVEEA---ELNCGQLADLLEFVEL 404

  Fly  1077 PQPFT----RIVKKGSGP 1090
            |:..|    |:|....||
  Fly   405 PKDTTILEDRLVGDPRGP 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chpNP_001263137.1 LRR <84..320 CDD:443914
leucine-rich repeat 84..103 CDD:275380
leucine-rich repeat 104..128 CDD:275380
leucine-rich repeat 129..152 CDD:275380
leucine-rich repeat 153..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
leucine-rich repeat 202..226 CDD:275380
leucine-rich repeat 227..250 CDD:275380
leucine-rich repeat 251..279 CDD:275380
leucine-rich repeat 280..326 CDD:275380
leucine-rich repeat 327..348 CDD:275380
leucine-rich repeat 352..375 CDD:275380
PPP1R42 355..564 CDD:455733
leucine-rich repeat 376..401 CDD:275380
leucine-rich repeat 426..450 CDD:275378
leucine-rich repeat 451..474 CDD:275380
LRR_8 473..559 CDD:404697
leucine-rich repeat 475..524 CDD:275380
leucine-rich repeat 500..519 CDD:275380
leucine-rich repeat 525..548 CDD:275380
LRR <540..>834 CDD:443914 42/164 (26%)
leucine-rich repeat 549..574 CDD:275380
leucine-rich repeat 575..598 CDD:275380
leucine-rich repeat 599..622 CDD:275380
leucine-rich repeat 623..646 CDD:275380
leucine-rich repeat 647..730 CDD:275380 8/29 (28%)
leucine-rich repeat 648..673 CDD:275380
leucine-rich repeat 674..705 CDD:275380
LRR <730..1081 CDD:443914 95/428 (22%)
leucine-rich repeat 731..754 CDD:275380 8/28 (29%)
leucine-rich repeat 755..778 CDD:275380 8/46 (17%)
leucine-rich repeat 779..802 CDD:275380 8/22 (36%)
leucine-rich repeat 803..823 CDD:275380 6/19 (32%)
leucine-rich repeat 852..876 CDD:275380 4/23 (17%)
leucine-rich repeat 877..900 CDD:275380 3/22 (14%)
leucine-rich repeat 901..925 CDD:275380 8/31 (26%)
leucine-rich repeat 926..946 CDD:275380 3/19 (16%)
leucine-rich repeat 947..970 CDD:275380 8/28 (29%)
leucine-rich repeat 971..993 CDD:275380 8/31 (26%)
leucine-rich repeat 994..1014 CDD:275380 5/19 (26%)
leucine-rich repeat 1019..1042 CDD:275380 2/22 (9%)
CG5810NP_650952.2 LRR <61..353 CDD:443914 80/366 (22%)
leucine-rich repeat 65..88 CDD:275380 6/22 (27%)
leucine-rich repeat 89..112 CDD:275380 5/22 (23%)
leucine-rich repeat 113..136 CDD:275380 1/22 (5%)
leucine-rich repeat 137..160 CDD:275380 8/22 (36%)
leucine-rich repeat 161..184 CDD:275380 6/22 (27%)
leucine-rich repeat 185..209 CDD:275380 3/23 (13%)
leucine-rich repeat 210..231 CDD:275380 8/32 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.